SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004899 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004899
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily E set domains 2.03e-17
Family Arrestin/Vps26-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004899   Gene: ENSTNIG00000002392   Transcript: ENSTNIT00000005045
Sequence length 187
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:51772616:51774332:-1 gene:ENSTNIG00000002392 transcript:ENSTNIT00000005045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVFSSGDVVSGRVLLDLFGEVRVSSLKLHAEFAKVHWTERSAGSSTAYTQNYSDEVEYLN
RREVLLQAVKDQWVKSGDEITARSRSSAGRHEFPFSFQLPEETLVTSFEGKHGSIRYWVK
VKLHPRATVKKIKKDFTVIEPIDINTPALLAPQAGTKDKLARAWYRNFGQVSVTAKIDRK
GYTPGES
Download sequence
Identical sequences H3C9H7
ENSTNIP00000004899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]