SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004934 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004934
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 1.54e-25
Family Calmodulin-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004934   Gene: ENSTNIG00000002418   Transcript: ENSTNIT00000005080
Sequence length 97
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:52058039:52058678:-1 gene:ENSTNIG00000002418 transcript:ENSTNIT00000005080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTVGGRVDFEDFTELMTPKLLAETAGMIGLKELKDAFKEFDIDGDGCITSEELRYAMIKL
LGEKANKSEIDALVREADHNGDGTVDFEEFVKMMSQQ
Download sequence
Identical sequences H3C9L2
ENSTNIP00000004934 ENSTNIP00000004934 99883.ENSTNIP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]