SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004955 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004955
Domain Number 1 Region: 43-183
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-30
Family C-type lectin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004955   Gene: ENSTNIG00000007776   Transcript: ENSTNIT00000005101
Sequence length 373
Comment pep:known_by_projection chromosome:TETRAODON8:16:976503:979400:1 gene:ENSTNIG00000007776 transcript:ENSTNIT00000005101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHPGSAFRLNGCPWLMLLSAPACLPGRALIPSQKICRRGTERPCYKVSYIHDSRRRLTFE
DASRACRVEGGELLSIETESEQRLVERFIHQLQAADGDFWIGLRRSPERYPAGASPVCPS
QYYWLDGSKAKYRNWHWDEPSCGGEMCVVLYYQPSAPPDEDGRFLFQWNDNNCNSKNNFV
CKYSEVKVPVFREGGGRGANAGPALSSTTEANERMKMGLTETVSASERLPYASPILYGTL
PALLLLLIAAAGFLSYKHRAKRYEQPDVFSVSSRRKTQTDGSRSKPQMGGAVSPYAVQGP
YAFSDISKLDAGPPADVETKYPGLPPQHSQCNDYENVPGPERESCFVTNDIYESSKAQGR
SGRSGWVENEIYG
Download sequence
Identical sequences H3C9N3
ENSTNIP00000004955 99883.ENSTNIP00000004955 ENSTNIP00000004955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]