SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005003 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005003
Domain Number 1 Region: 6-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-83
Family FCH domain 0.000000000938
Further Details:      
 
Domain Number 2 Region: 474-545
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005003   Gene: ENSTNIG00000013442   Transcript: ENSTNIT00000005149
Sequence length 559
Comment pep:known_by_projection chromosome:TETRAODON8:4:5663947:5685050:-1 gene:ENSTNIG00000013442 transcript:ENSTNIT00000005149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIFSPILQDQFDNLEKHTQWGIEYLEKYTKFVKERSEIELNYAKQIRNLSKKYQPKKNSR
EEEESKYTFCRAFLATLNELNDYAGQHEVIAENLVSQIITELVRYTQDLKAERKSHFHDG
RKAQQHIESSWKQLESCKKKFERDCKEADRANQYFEKLDADINVTKADVEKARQQAQMRQ
QMAADSKNDYSSYLQKFNQEQNEHYFTNIPAIFQKLQDMEEKRIEKLGVCMKTFAEVDRQ
VLPIVGKCLDGMTKAAESIEPKTDSKQVVESYKSGFEPPGDVEFEDYGQAMKRTASETSL
SNSKDGKEKSGSKSKGKLWPFIKNKNKGSGPEDFSHLPPEQRRKKLQGKLDDINKDIQKE
MDQRDALTKMKDVYIKNPQMGDPASVDPRLSEIGQNIEKLQFEAQKFEGWLAEVEERMPS
KSDTHRRSVLYEAQNSTTVGNNCAQDRESPDGSYTEEQNSETQVKAIVNPTSTTPDFDDE
FDDEESLPTIGTCKALYPFEGHNEGTIAMAEGELLYVIEEDKGDGWTRVRRNQDEEGYVP
TSYVEVFLETNAKGAMTYI
Download sequence
Identical sequences H3C9T1
ENSTNIP00000005003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]