SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005028 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005028
Domain Number 1 Region: 226-448
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.57e-87
Family Fibrinogen C-terminal domain-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005028   Gene: ENSTNIG00000002478   Transcript: ENSTNIT00000005174
Sequence length 452
Comment pep:known_by_projection chromosome:TETRAODON8:12:12593954:12597153:-1 gene:ENSTNIG00000002478 transcript:ENSTNIT00000005174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNDRWTIMNNSSSELDSKRPNPRRKWCRVLFWSIATLVIIVAIITTTVALLYLNRNKET
GLSSSPVITTNPRESGALVTVSRVTDGQPISIFLDPNCPDYNEKFVQWEALQSSLLQALS
GHGAGDWQETGLVHRLSEELKVILGHTHNLRVESEALKRGQSALEQRLDGLWSEQNRIIQ
MLSESHSGVRKLAAGFSDSLLSLKGETESLNAQSGFLLMSMPSVSLPSAARPRDCGDVQE
GSSHQSGVYSVFPTHDPDGFMVYCDMTTDGGGWTVIQRREDGSVNFFRGWEAYKDGFGKT
TGEHWLGLQRIYSLTRSGGYELRIDMADFDNATAFAHYAEFSVGRDSVNPEEDGYPLIVE
GYSGTAGDSLLKHSGMRFTTKDRDQDQSENNCASYYQGAWWYRNCHTSNLNGQYLRGGHA
SYADGVEWSSWTGWQYSLRFTEMKIRPQKHDY
Download sequence
Identical sequences H3C9V6
ENSTNIP00000005028 ENSTNIP00000005028 99883.ENSTNIP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]