SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005052 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005052
Domain Number 1 Region: 32-416
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.37e-96
Family Ankyrin repeat 0.00000822
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005052
Domain Number - Region: 1029-1092
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00149
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005052   Gene: ENSTNIG00000002502   Transcript: ENSTNIT00000005198
Sequence length 1508
Comment pep:known_by_projection chromosome:TETRAODON8:14:10114487:10123247:-1 gene:ENSTNIG00000002502 transcript:ENSTNIT00000005198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTTSIKMTTLAIQNLFGYVEEENLAALKAHLDRFKEVDGRSDNGQTPLMLAAEQGSLE
ILQELIRRGANVNLDDVDCWSALISAAKEGHVDVVKELLENSAYIEHRDMGGWTALMWAA
YKGRVEVTELLLQHGANTNTTGQYSVYPIIWAAGRGHAEIVKLLLQNGAKVNCSDKYGTT
PLIWASRKGHFDCVMHLLEAGADVDQEGANSMTALIVAVRGGYAAVVKELLKRKPNVNMT
DKDGNTALMIAAKEGHTQIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKY
ADIDIKGQENKTALYWAVEKGNATMVRDILQCNPDTETCTKDGESPLIKATKMRNVEIVE
MLLDKGAKVSAVDKKGDTPLHIAIRGRSRRLAELLLRNPKDGRLLYRPNKGGETPYNIDC
SHQKSILTQIFGARHLSPTETDGDVLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGK
SFLLKKLEGGVPARKNTHTHARATHTLPLSQAHGHTLLCVCCPREEEKQTCCVPSFLLCL
LVLACLFAGLALMAVVHVDGQNRTANGVLVAMGGVVAVALLLNVKTCWRLVDSVVNSQRK
RLHGAANRLHKLKSEAFINVLNHQVELMAKMAKTIDFTHHQTRLAVVIDGLDACEQDKVL
HMLDTVRVLFSKGPFISIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHLPVFLN
SRGLSSARKVAAAPSTNGDAANADGWQEEPDRKLSQHSLSELSRTAPGRRDTYRRRQAQR
SVTRQVSVDLSKLMVTEDWFSDISPQTMRRLLNIISLTGRLLRANQITFNWDRLASWINL
TEQWPYRTSWLILYLEDTQGVPDHAALKTLYERVSKNIPTTKDMEPLLEIDGDVRSFEVF
LSSRTPVLTAKDIRTFLPCTVNLDPKLREVIADVLAAREQMNVGGVNYPPLPLQEVQPRP
ASVYSQVSSACSPSASFSGAFHQPAGGVASPQPHSSYYSGLSGAQHPFYNRGEASVVSAA
SAVFLGSMTTEAICELLRQIDGIDASMLGQYSATVRKANVNGRVLSQCNIDELKKEMSMN
FGDWQLFRATVLNMRHMENQLLQEDAASEQGSVVGGGGEAGRRGGAPPPANADGSAMFTF
NLSFEELSTLGLEEPARAGGVAWMSAAQRTASMNSLNSQESSNDIGKLTDRQQAEYRSAY
QEYIAQMAQLEMGGGGGERPVQPQPGQFMTPPEDKSKDGGEQDGRKAFGKRNGGKAAPDN
PDFCSGDLLDPITEEDEHGAARTPRARRSSAERGGLFQGAADLKLKAGGGLRYQKLTSDE
HEWEESDSKAAARAPGGGAVLKAKDFLSESTLDKKESSDSGVRSSESSPNHSLQDEEAEL
SQLERSPLMELQEPAVVRMSICSEDQCSLLASSPEESWPSSGTFNLNRSPSNVTLNNNSH
AQHATAASSHRVGPSRSSTPSAGTRPGPNNENVRVVHLKRAVTPGDPPEICTMSCDTVTF
SEERESIL
Download sequence
Identical sequences H3C9Y0
ENSTNIP00000005052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]