SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005054 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005054
Domain Number 1 Region: 535-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.11e-68
Family Ankyrin repeat 0.000000908
Further Details:      
 
Domain Number 2 Region: 29-266,299-324
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.43e-64
Family BAR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 423-527
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.32e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0000207
Further Details:      
 
Domain Number 4 Region: 301-399
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-20
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 5 Region: 858-938
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005054   Gene: ENSTNIG00000002504   Transcript: ENSTNIT00000005200
Sequence length 940
Comment pep:known_by_projection chromosome:TETRAODON8:14:10102470:10109308:-1 gene:ENSTNIG00000002504 transcript:ENSTNIT00000005200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASGEFVEETSEDYKAPTTSSFTTRMVECRNAVTALEEALDVDRSVLYKIKKSVKSMNAS
GLAHVENEELYIHNVEKFGQNLTGRDQVQVGSAFLQFSAFAKELMDLFRNLMQNMNNIIS
FPLDSLLKGDLKGVKGDLKKPFEKSWKDYEAKLTKIEKEKREQARQYGMIRTEFSGGEIA
EEMEKERRLFQLQMCEYLLKVNEINVKKGVDFLQSLIKYFHAQCNFFQDGLKAVETLKPS
VEKLATELTSIKQNHDGERKQLSQLRDVLKASLQCEGREDAPARANAGYSLHQLQGNKAH
GTERSGLLYKRSEGLRKVWQKRKCSVKNGFLTICHGTGNRPPAKLNLLTCQVKRNPEEKK
SFDLFSHDRTYHFQAEDEAECQLWVSVLQNSREEALARAFKDDQEDGNNIVQELTRAIVE
EVKRMSGNCCCDCGAAAPTWLSTNLGVLICIECSGIHREMGVHYSRIQSLDLDVLGSSEL
LLAKNVGNASFNQIAEADLAVHGVAKPDASSDMQARKDFITAKYEKRFTRRLSPDAASRR
QLLYEAVRKRDVLSLIQVYFEGLDLMDTCPQPNEHEPGETALHLAVRMGDRNSLHIVDFL
AQNSANLDKQTERGSTALHYCCLMDNSECLKLLLRGRASVSITNEGGETPLDIARRLHHP
QCEELLAKAQTGKFNAHVHVEYEWCLQNQDLDESEDELEDKCQPILIRREERPISCLVPG
AGSGRAAVAHDAAGPARDRQRSQIPSMMISNETYGTLLDLNQTPPLPPRDPSGGRSAAPP
PRDQHLNACLGSPPPANTRTSMLAGKVQSAPDTSLPPAPPVIPLPPVLPVSTKAPPIPPP
VPSHQAGRAPGLPGATGPPHSPAPPPPTPKPRSAFSKQRPQRVKAIYNCSADHPDELTFS
EGEVLVVDGEEDSDWWFGHVENEPSRRGVFPVTFVHFITD
Download sequence
Identical sequences H3C9Y2
ENSTNIP00000005054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]