SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005082 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005082
Domain Number 1 Region: 326-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.043
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005082
Domain Number - Region: 97-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0453
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005082   Gene: ENSTNIG00000002531   Transcript: ENSTNIT00000005228
Sequence length 407
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:38472756:38475425:1 gene:ENSTNIG00000002531 transcript:ENSTNIT00000005228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVVAVALCQEPDPSHVCAQGSCYPATGDLLVGREKNLKASSTCGLRRKERYCIVSHLQD
EKKCFDCDSRRPYDPVYNTINHRIENVITTFKPHRKNSWWQSENGRERKSEVFIQLNLEA
EFHFTHLIMTFKTFRPAAMLIERSADFGRTWQVYRYFSHDCSQNFPGVSQGPLRNINDII
CESRYSDIEPSTEGEVIYKVLDPSIVIEDPYSPTIQDLLKITNLRVNFTRLHTLGDNLLD
PRLEIKEKYYYAVYELVVRGNCFCYGHASECAPISGATAGLDGMVHGRCVCNHNTKGMNC
ERCEDLYNDLPWMPAEGRNSNACRKCNCHGHAHTCHFDMAVYLASGNVSGGVCDHCQHNT
MGHACDMCKPFYYRDPLKDSRDPQVCSACDCDPDGSQDGGLCDGHTD
Download sequence
Identical sequences H3CA10
ENSTNIP00000005082 ENSTNIP00000005082 99883.ENSTNIP00000005082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]