SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005083 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005083
Domain Number 1 Region: 333-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 770-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 3 Region: 269-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 4 Region: 818-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 5 Region: 971-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 6 Region: 409-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 7 Region: 864-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 8 Region: 508-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 456-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 10 Region: 1080-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1023-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 12 Region: 1128-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 13 Region: 922-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family Laminin-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005083
Domain Number - Region: 1549-1770
Classification Level Classification E-value
Superfamily Tropomyosin 0.00203
Family Tropomyosin 0.002
Further Details:      
 
Domain Number - Region: 105-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0632
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.045
Further Details:      
 
Domain Number - Region: 1215-1326
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0981
Family CorA soluble domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005083   Gene: ENSTNIG00000002532   Transcript: ENSTNIT00000005229
Sequence length 1783
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:38502124:38516462:1 gene:ENSTNIG00000002532 transcript:ENSTNIT00000005229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQQSFFPFGSVLVVAVALCQEPDPSHVCAQGSCYPATGDLLVGREKNLKASSTCGLRRKE
RYCIVSHLQDEKKCFDCDSRRPYDPVYNTINHRIENVITTFKPHRKNSWWQSENGKSEVF
IQLNLEAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQVYRYFSHDCSQNFPGVSQGPL
RNINDIICESRYSDIEPSTEGEVIYKVLDPSIVIEDPYSPTIQDLLKITNLRVNFTRLHT
LGDNLLDPRLEIKEKYYYAVYELVVRGNCFCYGHASECAPISGATAGLDGMVHGRCVCNH
NTKGMNCERCEDLYNDLPWMPAEGRNSNACRKCNCHGHAHTCHFDMAVYLASGNVSGGVC
DHCQHNTMGHACDMCKPFYYRDPLKDSRDPQVCSACDCDPDGSQDGGLCDGHTDSSLGLV
AGQCRCKANVDGARCDRCKAGFFGFSADDPRGCQPCQCDRLGTVLGSSQCDPVSGDCFCK
RLVTGRTCNTCLPEHWALSHDLNGCRACECDVGGAVDNHCLAESGQCRCRSHMTGRQCSQ
VESGYFFMALDFLLYEAELAKMGQSCHLETREQQAGRPATWTGVGFAHVPEGGTVDFHIA
NIPYSMEYDLLIRYESQMPRDWEEVRISVIRPGSIPTSSPCGNTIPDDDRLSVFLPAGAR
FMSLSRPVCLERGVAYTLRFEFTRYQDANSVLNGAAGAVLLVDSIALMPRHSSMEMFSAG
DPASNSRKQNFERYRCHEGAKSVIRSPMSSTCSKLLSSMSAVVNDGALPCRCDPQGSSSS
VCDVRGGQCPCRANVIGRRCDQCAPGTWGFGPAGCKACGCSLEGSASRLCDRHTGQCTCH
AGAFGKHCDGCRAGHWGFPNCRPCRCHGHADGCDQRTGACIGCRANTGGAHCERCADGHY
GNPNTGPCHPCPCPDGPNSGRHFAATCYQDNQSRRVICSCNQGYTLGDRCGACAPGHYGN
PSQPSGRCQPCRCNNNIDMSDTEACDRRTGECRKCLYNTEGPDCGVCRSGYFGDASKRNC
RKCTCHFLGTEPSQCVEREDCVCQRASGQCQCRPNVTGLTCDHCAPEHWNLASGSGCEPC
GCHPNNSVSSSCNEFSGQCQCRSGFGGKTCTECEENYWGDPGTQCRACDCDRRGIETSQC
NRRTGHCVCLPGVSGVRCDQCARGFSGQFPHCQPCHQCFGDWDRIVQDLAVRSRALAERA
NDIQNTGLTGAYEKFFRNLESKLAQAQGIVNTRNATASAVALLMELTEDLRAQISETTDT
LNHLEGDLTVVQDSSSEASKELSALEREARELNLTSEQLHQQLDILKNSNFLGAYDSIRS
SYSRSQDAERLANESAVTKSSIVVQSGRTRHRMEQLLTAKKDDFSRKNAANKRALGDLSG
RLQGLDLKKVNEKVCGTPDDAPCGESPCGGAGCRDDDGNPHCGGLNCDGAVAAADNALER
GKHAEKELNKAMREVEALFIKVVEVKGKAEEAKGKAQAALDKALASRKNTERSNNELRDL
IKQIREFLMQEEADPDSIEAVANRVLELSIPASPLQIRHLAEEIKEKVSSLSNVDAILQQ
TRDDIRKAEQLLLEAKTARHQAENAKATTEAVKKALFNCRTAQTSAEKAIRTAKADILDT
EARLAQIELKTSKRERDLNVTIVHLETLGREINALKTKCASNSMAAARAEETATMARDKA
NEAKQILDGQLTDKYHEVQQRVGTKAKAVMDAKKRAESLRDEATKLLQDAQRKLRMLAEL
EKNYEENQRKLEGKAHQLDGLEDKMKAILNDINKQIQIYNTCQ
Download sequence
Identical sequences H3CA11
ENSTNIP00000005083 99883.ENSTNIP00000005083 ENSTNIP00000005083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]