SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005091 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005091
Domain Number 1 Region: 160-214,254-297
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000011
Family BRCT domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005091   Gene: ENSTNIG00000002540   Transcript: ENSTNIT00000005237
Sequence length 325
Comment pep:known_by_projection chromosome:TETRAODON8:21:782263:784905:1 gene:ENSTNIG00000002540 transcript:ENSTNIT00000005237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMSGGSNFGFSGIGQANTGTPTHYRKDGSPSAWFWESPDTLAQLEGVRQWIGKHYKKY
VLVDPPSCQALATVTLQLLQFQEDAFGRQAADPALTKLPIHCFLDLRPGGGLCHILGTAH
KFKAEQGWRRFDLQNPSRTERNVEMFAAIEVALVQNSCVSQPVVYLDHMLDHELASKLTT
IIVKHQGTLTDDRILASHHVFPLNSSTNDDNWMRPVVQKDKHVLVHWGMHPDSYDSWLSS
SEVDGKVEEPPHTEKPWRVPADWVLDTDVFNEWMNEEDYLVNERNIPVNFRQRISLREEQ
DTKSTPIKKRRRSPSPSSESRKKGR
Download sequence
Identical sequences H3CA19
99883.ENSTNIP00000005091 ENSTNIP00000005091 ENSTNIP00000005091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]