SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005117 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005117
Domain Number 1 Region: 554-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.81e-89
Family Eukaryotic proteases 0.00000743
Further Details:      
 
Domain Number 2 Region: 301-407
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 3 Region: 191-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 484-520
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 448-483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 408-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 58-142
Classification Level Classification E-value
Superfamily SEA domain 0.000000248
Family SEA domain 0.0076
Further Details:      
 
Domain Number 8 Region: 524-565
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000309
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005117   Gene: ENSTNIG00000002566   Transcript: ENSTNIT00000005263
Sequence length 814
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:52992995:52998684:1 gene:ENSTNIG00000002566 transcript:ENSTNIT00000005263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFLPATDTKPLEKMSGRRKKLWMGLGLLLLAAAVALTTGLLVWHFNAVSDVRVERLYIG
AMGLRDQPFLKSYEEPSSPQFDQLASLVCQQLETMFSRNSVLAKSFSGCTVQSFSEGTGA
TRTVAYYQSQFEVHVSQQASLDEAVQSMQLLLGDPDGHKGRLQLRPADRLSVSNVMAQVK
KTFNIHVREKGDVRSPGFPGSSYPPNVYLQWRLRADPGHRIQLDFQTLILDDDCQQDFIR
IYDSLAPLEHRVLTEQCGYPHGSLSFLSSGHVMLLTLLTNEERNFPGFIANYSQIPLSRA
SCGGRLRGDRGFLSSPFYPAHYPPQTSCVWEIQATKDQFVKVQFNTFLLGNGSDGCPGDY
VEINGQRLCGRKPERTVVTSRSNTMTVTFTSDASYVDQGFHAEYTAFVPTDPCPGSFWCH
NNLCLNPALRCDGWDDCGDNSDERDCQCDASQLRCQNGRCKPKFWQCDGTDDCGDNSDED
NCVKCKPGEFLCRNQRCVPESRRCDGRDDCSDGSDESQCKRSVLLQQCSEHSFRCRNGKC
ISKLNPDCDGELDCEDASDEDGCHCGKRPYRSSRIVGGQVSQEAEWPWQVSLHIKGTGHT
CGASVLSNRWLLTAAHCVRNPGSAMYSQPEQWEVLLGLHEQGQTSKWTVKRSVKQIIPHH
RYDPVTYDNDIALMELDANVTLNQNIYPICLPSPTYYFPVGSEAWITGWGATREGGRPAS
VLQKAAVRIINSTVCRSLMSDEVTEGMLCAGLLRGGVDACQGDSGGPLSFTSPSGRVFLA
GVVSWGDGCARRNKPGVYTRTTQYRSWIREKSGV
Download sequence
Identical sequences H3CA45
ENSTNIP00000005117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]