SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005133 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005133
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.67e-60
Family BAR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 375-491
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.32e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00014
Further Details:      
 
Domain Number 3 Region: 227-333
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-25
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 4 Region: 578-697
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-24
Family Ankyrin repeat 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005133   Gene: ENSTNIG00000002581   Transcript: ENSTNIT00000005279
Sequence length 715
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53080791:53093413:-1 gene:ENSTNIG00000002581 transcript:ENSTNIT00000005279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQLVKLCSGMIEAGRVYVSANKLFVNGIKDLSQQCKKEETISACGTMCSRNSSKVLGFH
LVILFDQAQRSIKQQLHTFIKEDIRKFKDTKKQFDRVREDMELAQVKNAQAPRNKVHEAE
EATQALVLSRKAFRHLALDYVLQINVLQAKKKFEILDAMLSFMHAQYTLFQQGYNILDEI
DPYMKKLAAQLDQLVIDSAMEKREMEHKHALIQQRDFSYDDPKLEFNVDAPNGVVMEGYL
FKRASNAFKTWNRRRWFSIQNSQLVYQKKFKDSLTVVVEDLRLCSVKPCEDNERRFCFEV
VSPTKSCMLQAESEKLRQAWIQAVQASIASAYKDITDNYYFERLDRTASPSTSSIDSASE
LRERVDRGARGGGESLLQRVQSLPGNELCCDCGQSSPCWASINLGILLCIECSGIHRSLG
VHCSKVRSLTLDSWEPELLKLMCELGNTVINQIYEGACEELGAKKPGLSSSRQQKEAWIK
SKYVEKRFLKKMSGNEALVEVTRKSHSTFMSELKSLISFLQQQQQLQTHYSAQIFATFSV
TRQLSEEESEESSSGEVEIEQEVPSDPEDPRELHPGALLYRASHLHNLPLMAEALAHGAD
VHAASEEEEGKTPLIQAVMGGSLIACEFLLQNGADVNQRDMRGRGPLHHATYLGRTGQVC
LFLKRGASQTEVDEQGHDPLSIAVQAANADIVTLLRLARMNEEMREAEAPLGQPG
Download sequence
Identical sequences H3CA61
ENSTNIP00000005133 ENSTNIP00000005133 99883.ENSTNIP00000005133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]