SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005140 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005140
Domain Number 1 Region: 127-391
Classification Level Classification E-value
Superfamily vWA-like 8.15e-88
Family Trunk domain of Sec23/24 0.000000915
Further Details:      
 
Domain Number 2 Region: 8-66,408-518
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.96e-60
Family beta-sandwich domain of Sec23/24 0.00029
Further Details:      
 
Domain Number 3 Region: 617-756
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.66e-48
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000113
Further Details:      
 
Domain Number 4 Region: 519-615
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.57e-41
Family Helical domain of Sec23/24 0.0000136
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 6.15e-22
Family Zn-finger domain of Sec23/24 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005140   Gene: ENSTNIG00000002588   Transcript: ENSTNIT00000005286
Sequence length 760
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53219253:53224071:-1 gene:ENSTNIG00000002588 transcript:ENSTNIT00000005286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFPEYIAQNEDRDGVRFSWNVWPSSRLEATRMVVPVACLLTPLKERPDLPPIQYEPVL
CSRATCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISEVNQPAELLPQFSTIEYV
VQRGPQMPLVFLYVVDTCMEDEDLQALKESLQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLTKPGATQGRAPQAAQQPLSNRFLQPVQKIDMNLT
DLLGELQRDPWPVTQGKRPLRSLGVAMSIAVGLLECTFPNTGARIMTFIGGPATQGPGMV
VGDELKIPIRSWHDLEKDNAKYTKKATKHYEALANRASANGHIMDIYACALDQTGLLEMK
CCTNSTGGYMVMADSFNTSLFKQTFQRVFTKDLQGSFKMAFGAALEVKTSREIKVSGAIG
PCVSLGAKGPSVSENDMEIGNGGTCQWKMCGLDPTTLALYFEVVNQQHNAPIPQGGRGAV
QFVTQYQHSSGKRRIRVTTIARNWADAQSQIQSIAASFDQEAAAILMARLSVYRAETEEG
PDVLRWLDRQLIRLCQKFGDYHKDDPNSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDE
SSYRHHLQQALIMIQPLYAYSFNGPPEPVLLDSSSMPARIRILLMDTFFQISHLPVDTVA
QWRKAGYQEMPEYENFKHLLQAPVDDAQELLHTRFPMPRYIDTEHGGSQARFLLSKVNPS
QTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences H3CA68
99883.ENSTNIP00000005140 ENSTNIP00000005140 ENSTNIP00000005140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]