SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005144 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005144
Domain Number 1 Region: 31-170
Classification Level Classification E-value
Superfamily PX domain 0.00000000000294
Family PX domain 0.014
Further Details:      
 
Domain Number 2 Region: 205-400
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000767
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005144   Gene: ENSTNIG00000002592   Transcript: ENSTNIT00000005290
Sequence length 405
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53247505:53250603:1 gene:ENSTNIG00000002592 transcript:ENSTNIT00000005290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQEGLDDGPDFLSEEERGPRAVNVDLQTDATLQVDISDALSERDKVKFTVHTKSTLSNFK
QNEFSVVRQHEEFIWLHDSFVENEEYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKE
EFTKMKQELEAEYLAIFKKTVAMHEVFLCRIAAHPVLRKDLNFHVFLEYNQDLSVRGKNK
KEKLEDFFKNVVKSADGVLVAGVKDVDDFFEHEKTFLLEYHNRVKDASVKSDRMIRSHKN
SADDINRIASSLYALGTQDSTDLCRFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYL
RESQAAKDLLYRRGRLVDYENANKALDKARAKNRDVLQAETSQQLCCHKFEKISESAKQE
LIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLHSCLGILKGNT
Download sequence
Identical sequences H3CA72
ENSTNIP00000005144 ENSTNIP00000005144 99883.ENSTNIP00000005144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]