SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005147 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005147
Domain Number 1 Region: 77-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-40
Family Galectin (animal S-lectin) 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005147   Gene: ENSTNIG00000002595   Transcript: ENSTNIT00000005293
Sequence length 216
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53273163:53274189:1 gene:ENSTNIG00000002595 transcript:ENSTNIT00000005293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQLKDALDGWSSSTNAPRGGPSGPGQPNPLLWPGHPPPDPLWSGASSGGGALWPGSGGP
AFPGPAAGPGPAPGRLTVPHEEELPAGVFANLLITINGSVHQHANKITVDLTTERADLAF
HFNPRFNENGQQVIVRNSCVGNQWGPEERDLLGGFPFVKDKPFEMKILCTDHEFRVAVDE
RHLLAFQHRVRDLRSIRKLSIYNDLSLSAVRLETLR
Download sequence
Identical sequences H3CA75
99883.ENSTNIP00000005147 ENSTNIP00000005147 ENSTNIP00000005147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]