SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005157 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005157
Domain Number 1 Region: 2084-2159,2186-2280,2401-2577
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.41e-83
Family Hect, E3 ligase catalytic domain 0.000049
Further Details:      
 
Domain Number 2 Region: 363-485
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-25
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 1272-1339
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.31e-22
Family Mib/herc2 domain 0.0000132
Further Details:      
 
Domain Number 4 Region: 10-215,512-639,893-932
Classification Level Classification E-value
Superfamily ARM repeat 9.05e-20
Family Armadillo repeat 0.021
Further Details:      
 
Domain Number 5 Region: 1091-1243
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000449
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005157   Gene: ENSTNIG00000002605   Transcript: ENSTNIT00000005303
Sequence length 2585
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53398234:53411016:1 gene:ENSTNIG00000002605 transcript:ENSTNIT00000005303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLSFIRDSGHLVHKDTLHSAMAVVSRLCSKMEPQ
DPSLETCVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLCRM
AAAGGAASGPPSSCKPGRASTGAGPPAPDSKLSNQVSTIVSLLSTLCRGSPLVTHDLLRS
ALPDSMESALGGDERCVLDTMRLVDLLLVLLFEGRKALPKSTAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDDKKKKDVNKEEEEGSEPKGDPEMAPVYLKRLLPVFAQTFQQTMLPSI
RRKASLALIRKMVHYSSEVLLREVCDSESGHNLPTVLVEITATVLDQEDDDDGHLLALQI
IRDLVDKGGDVFLDQLARLGVINKVSTLAGPASDDENEDESKPEKEEEVQEDAREIQQGK
PYHWKDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSE
SRSEFLEKLQRARSQVKPVTSSQPILSTVAPTKLTVGNWSLTCLKEGEIAIHNSDGQQAT
ILKEDLPGFVFESNRGTKHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVKSMARE
LYDDHFKAVESMPRGVVVTLRNISTQLESAWELHTNRQQCVEGENTWRDLMKTALENLIV
VLKDENTISPYEMCSSGLVQALFTVLNNVSVPRLLLHPQGPLMERINVFKAAFSENEDNE
SRPAVALIRKLIAVLESIERLPLHLYDTPGSLYNLQILTRRLRFRLERAPGETALIDRTG
RMLKMEPLATVESLEQYLLKMVAKQWYDFERSSFVFVRKLREGQSFTFRHQHDFDENGII
YWVGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDSSALNCHTNDDKNAWF
AVDLGLWVLPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT
WPLDPSKEEKQGWRHIRIKQMGKNASGQTHYLSLSGLELYGTVTAVCEDQLGKAVKEAEA
NLRRQRRLFRSQVMKYIVPGARVVRGIDWKWRDQDGNPPGEGTVTGEAHNGWIDVTWDAG
GSNSYRMGAEGKFDLKLAPGYDPESAATAPSPKPVSSTVSGPSSMQQQQSWSSLVKNNCL
DTPLGGASSSSRKGSSSSVCSVASSSDISLSSSMGLMGVGGLRLEKRAEGLLLDQGVGVG
VGTGGGVGSDVQQLEPIVVLSSVVDSGSGSASSSGTLPTDAAAPGDESRSKDSGTDPATA
ISMGLVSVSSPDVSSVSESSGKDAPSQRPLCSATNARLSVSSLLAGAPMSSSASVPNLSS
REASLMESFVRRAPNMSRTNATNNMNLSRSSSDNNTNTLGRNALTTATSLMGAQSFPNLT
TTGTTSTVTMSTSIVTSSNNVATATTGLSVGQLLSNTLTTSLTSTSSESDTGQEAEFSLY
DFLDSCRANTLAELDDEEDLPEPDDDDDENEDDNQEDQEYEEVLVIQPSLAFWSGTGSDV
TVQEEEEYETKGGRRRTWDDDFVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGRSPR
SEVQEEVECAPSPHLSLTLKVAGLGTSREVELPLSNYKSTIFFYVQRLLQLSCSGAVKTD
KLRRIWEPTYTIMYRELKDADKEKESAKTVRRVWALSHPLTCCVLQDVCEHGTGFSARSG
VLSPGSLLASQSGEILGVAREMAQAKAGCSQNACGVEDVLQLLRILYIIGGDSASNTRTM
QEDFEELQFNASPEEFTSKKITTKILQQIEEPLALASGALPDWCEQLTAKCPFLIPFETR
QLYFTCTAFGASRAIVWLQNRREATMERSRPSTTVRRDDPGEFRVGRLKHERVKVPRGEA
MMEWAESVMQLHADRKSVLEVEFQGEEGTGLGPTLEFYALVAAEFQRTSLGIWLCDDDFP
DDESRQVDLGGGLKPPGFYVQRSCGLFPAAFPQDSEELERIAKLFHFLGIFLAKCIQDNR
LVDLPLSQPFFKLLCMGDIKSTWSRQLYQSCSFPPGQEPERLHLQPFLLLSESEASTEES
QETYSVGSFDEDSKSEFIMDPPKPKPPAWYHGILTWDDFQLVNPHSRASFLKELKELAMK
RRQILSSKSLSEDEKNTRLQDLMLRNPLGSGPPLSIEDLGYPPLLNFQFCPSSKVHGFSA
LDLKPNGDNEMVTMENAEEYVELMFDLCMHTGIQKQMEAFREGFNRVFQMEKMSSFSHKE
VQMILCGNQSPSWTADDIINYTEPKLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGC
STLPPGGLANLHPRLTIVRKVDATDSSYPSVNTCVHYLKLPEYTSEDIMRERLLAATMEK
GFHLN
Download sequence
Identical sequences H3CA85
99883.ENSTNIP00000005157 ENSTNIP00000005157 ENSTNIP00000005157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]