SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005199 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005199
Domain Number 1 Region: 233-356
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 445-570
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.0049
Further Details:      
 
Domain Number 3 Region: 130-237
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 348-450
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-21
Family Cadherin 0.0066
Further Details:      
 
Domain Number 5 Region: 561-669
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-18
Family Cadherin 0.0045
Further Details:      
 
Domain Number 6 Region: 32-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005199   Gene: ENSTNIG00000002645   Transcript: ENSTNIT00000005345
Sequence length 1015
Comment pep:known_by_projection chromosome:TETRAODON8:1:4865:16121:-1 gene:ENSTNIG00000002645 transcript:ENSTNIT00000005345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTARRCYSVKKSVPFSFCLLIIVFSGLTDAQIRYSIPEELENGAPVGDIIRDLGLDPR
KLSTRRIRVTSDGTHRRYFAINHKTGKLTVSDRIDRETVCEFSTCSLNLEVVLENPLDVH
NVEVEILDVNDNAPQFPRDEYQLEVSESALTGSRFHIEGAQDADDGSNAVKQYRLSRNDH
LTLDSVKQFTNNKHIELILKKPFDRELMPSHQLILTAIDGGTPQRSGTARINVRVLDAND
NAPVFGSLTYKVKLSENSVKGSLVIKLNATDIDEGSNGNVFYSFSSYTPERVRQMFSLDT
DTGEIRVKNNIDYEETNSYEMYIQAMDKGPAPVAAHCKVVVDILDENDNVPEIVLSSLSS
PVREDARADTVVALISVNDRDSGLNKQVTLEIGPNLPFTIKSFRNHYTVVTSAFLDRETI
RSYNVTVSAVDGGTPPLSSQMSFMVEVADVNDNPPRFEQTSYTVYVTENNARGASLCIVK
ATDADAAENARITYTVISDNNYGIHVASYVSIKPNTGEAYALRAFDFEKLREFHFQVKAQ
DNGVPPLSRVVTVYVYIMDQNDHAPRIFYPPANGSHATEMLMKNAEAGVLVSKVVAWDGD
AGQNAWLMYTLKQTSTDLDLFKVHEYTGEIRTTRHVIEDNSTSFILTVLVRDHGLPPLSS
TATLHVHVMEPAPKITPDPKRIIRPNSPLKFSKVTIYLIIALCATTFVFLVTVFVLAIVR
CHAYCTQPGSCSPCCVSKKNVPEGGIPASGGGGGGGGGGGGAGRAASGGGAGGGGGQASA
NVALRRDLKVEPHYIEVRRNGSMTKTYCYKTCLTATSGSDTFMFYNTGRPHSGTWGSGYV
TSHSGQSQIFVRRLSMPDATAIQPKMPSADWRYSASLRAGGVMQSSVHMEESSVMQGAQG
VLVQNWPTASSAADAEGGEVSPPMGAGVDSNSWHFRYGPGGPGAPPQHLKPGEVPPEAFI
IPGSPAIISIRQNQGGEDDKSDFITFGKKEEAKKKKKKKKEKKDKKDKGKDDGDE
Download sequence
Identical sequences H3CAC7
ENSTNIP00000022868 99883.ENSTNIP00000005199 ENSTNIP00000005199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]