SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005229 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005229
Domain Number 1 Region: 17-136,327-635
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.75e-70
Family Integrin alpha N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 156-350
Classification Level Classification E-value
Superfamily vWA-like 1.78e-45
Family Integrin A (or I) domain 0.0000022
Further Details:      
 
Domain Number 3 Region: 639-782
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-27
Family Integrin domains 0.0065
Further Details:      
 
Domain Number 4 Region: 785-939
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000131
Family Integrin domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005229   Gene: ENSTNIG00000002675   Transcript: ENSTNIT00000005375
Sequence length 1192
Comment pep:known_by_projection chromosome:TETRAODON8:13:12738223:12746828:1 gene:ENSTNIG00000002675 transcript:ENSTNIT00000005375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDGGKGRLLSWADLLCFNFHTKKVWIFPGSEEARFGSTVQQHQAGGRQWLLVGAPFQTSG
RKRTGDVFRCPLDNGTSEGCSRLHLGNLSLDSVSQRAEEMRLGLTLTSDPRDSSFVTCGP
LWSHECGSSLYSTGICSRVSRTFRPTGTIAPALQRCETFMDIIIVLDGSNSIYPWSEVQN
FLINILHKFFMGPGQTQVGVVQYGSSVVQEFRLGEHRTVEEVVVAARSIRQRGGEETRTA
LGMEVARSQGFGRGGRPGARKVMIVITDGESHDSAQLPQAVARSNRDNITTYAIAVVLGS
YNRRGMDPEAFLEEIRLIASDPDQEHCFKVTDESALKDIVDALGERIFSLEAGASPRGRG
FGLQMAQAGFSAHLVKDGVLLGAVGANDWNGAVLKDTKDGKVVPPRSSYEDEFPEELKNH
GAYLGYSVGSLISSDGSQLYTAGAPRFNHTGKVIVFTLADSGNLTVLKALLGEQIGSYFG
SQLLSMDVDGDGRSDVLLVAAPMYYSQGWERGKVYVYGVTPELALVLQGALEASDGAQNA
RLGSSMAAIGDMNGDGFQELVVGAPLEDDHQGAVYVFYGRGRTIQRRHRQQRLPAAGFSA
GLRYFGQSVHGVLDVNGDGLVDLAVGALGAAAIIWSRGVVRVQAGLLFQPEKVDVSNKDC
RRGGKAAACMAVTVCLSLSSRTSATATVGADVWYSLAFDEGRSPPRAVLEEPDQQQLSRL
FLQTGSQSCRHHAFSVQETSDYGHPITVVLETGLQDPDRGPVLDPDQPSVLRAALPFWNG
CDQEDACVPDLVLHAGTDLLDVGQFCSSGSVWSVCGHRSAAEGGAGVVEARRRKVAVLAR
LENRGENAYAAALRVSTSSNLLFSGLVLKDQSDVEMECFSESRAAGELSCNVSAPFLKPS
AQVSFRLEFELRPALLLDHIQVVMATSSEGRDRNPEDNICYIFLPLRYQADLLFTRDPNP
LRFQIQAGGPAPFSWSQGGADSCHDFNLTYQIRNLGTLPVHGLVFRAEIWAVTRGGNQLV
EMLDLGLDQEEEEGRPSGASSFLPNGPAAEDLSHLSQLNRSNGASVAAQCGLHLPASTQL
EVRLRGRLLCPALLAVGFRALEVMTTASIRMDASSPAFLQEDLAVREIILEIRKEGDYIN
PVWIILGSSLGGLLLLALLVLALWKIGFFRRQRPEEEEEQPVANGKAAEELS
Download sequence
Identical sequences H3CAF7
ENSTNIP00000005229 99883.ENSTNIP00000005229 ENSTNIP00000005229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]