SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005233 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005233
Domain Number 1 Region: 82-396
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.42e-70
Family Glutaminase 0.00016
Further Details:      
 
Domain Number 2 Region: 423-504
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000138
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005233   Gene: ENSTNIG00000002679   Transcript: ENSTNIT00000005379
Sequence length 505
Comment pep:novel chromosome:TETRAODON8:13:12697932:12709211:1 gene:ENSTNIG00000002679 transcript:ENSTNIT00000005379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAADVLFDSFASEQRLHVSQFFEAIWNSGLHKSDPRLRECLVHLRKLQDADGCADRDTFH
SCITGSVSLVLKALQGRFVIPDFCTFTEETQKLFSRCRQLLSVQVSALDQELIEVDPDTN
MKWGVAICTVDGQSRLTLGDWAGSLALGELSWPLVYGVAVDLLGSDLVHRYVGVDGYSRY
DSPFTLTKAGIPHSPLTETGAIITAALLQGVLSAEEEEKFDSVLNVIQRLCNKEHARLNC
SSLQRSRTAGVRLHALSFYLQEKKCFPDEVDVSAALDLMLQCSATELTCESGAALAASLA
NGGLCPLSGDQVLSPGATRSVLSMMQVAGMKDYSTAFQYKTSIPAASSSHGALLAVVPGV
LGLAAFSPEVDASGNPWRAVHFCQELVSTFQLHAFDIRTPFRQILAYRQWKAESEGSQIM
NVLLAASRGDEQALRRYFLSGVDVKAVDYDGRSALHVAAAEGHVQVVRFLLENAGANPAL
KDRWGSSPLQEARRHHREAAEELLQ
Download sequence
Identical sequences H3CAG1
ENSTNIP00000005233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]