SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005234 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005234
Domain Number 1 Region: 138-449
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.34e-71
Family Glutaminase 0.00016
Further Details:      
 
Domain Number 2 Region: 476-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000233
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005234   Gene: ENSTNIG00000002679   Transcript: ENSTNIT00000005380
Sequence length 558
Comment pep:novel chromosome:TETRAODON8:13:12703021:12709211:1 gene:ENSTNIG00000002679 transcript:ENSTNIT00000005380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNYMCSPGLHQNRGGRGGVSGGPGGFGPVSSFIKDTLHAHAPASSKHPSGCFRAADVLFD
QFASEQRLHVSQFFEAIWNSGLHKSDPRLRECLVHLRKLQDADAARTGTPSTGFFCSCIT
GSVSLVLKALQGRFVIPDFCTFTEETQKLFSRCRQLLSVQVSSALAAFSLCRNAEWGVAI
CTVDGQSRLTLGDWAGSLALGELSWPLVYGVAVDLLGSDLVHRYVGVDGYSRYDSPFTLT
KAGIPHSPLTETGAIITAALLQGVLSAEEEEKFDSVLNVIQRLCNKEHARLNCSSLQRSR
TAGVRLHALSFYLQEKKCFPDEVDVSAALDLMLQCSATELTCESGAALAASLANGGLCPL
SGDQVLSPGATRSVLSMMQVAGMKDYSTAFQYKTSIPAASSSHGALLAVVPGVLGLAAFS
PEVDASGNPWRAVHFCQELVSTFQLHAFDIRTPFRQILAYRQWKAESEGSQIMNVLLAAS
RGDEQALRRYFLSGVDVKAVDYDGRSALHVAAAEGHVQVVRFLLENAGANPALKDRWGSS
PLQEARRHHREAAEELLQ
Download sequence
Identical sequences H3CAG2
ENSTNIP00000005234 99883.ENSTNIP00000005234 ENSTNIP00000005234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]