SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005251 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005251
Domain Number 1 Region: 30-243
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.18e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 528-739
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.21e-56
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 239-370
Classification Level Classification E-value
Superfamily E set domains 4.67e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 798-876
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000153
Family DEATH domain, DD 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005251   Gene: ENSTNIG00000002693   Transcript: ENSTNIT00000005397
Sequence length 879
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53878742:53891854:1 gene:ENSTNIG00000002693 transcript:ENSTNIT00000005397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFDLPMLDAPWDFTPFPAMAQAPSLRTVDGPFLQIVEQPKQRGFRFRYGCEGPSHGGLPG
ASSEKNRNTYPTINVNNYQGPARVVVQLVTALHQSPQLHAHSLVGKQCEKGICTADLQPK
LPVLCSFPNLGILHVTKKNVTKTLEERMVEAFRMGHNYGVCIHPEIDGQQGEVRVPRELT
DHQRSLISSAAAVQAKDMDLSVVRLMFTVFLPDSDGGFSRRLEPVVSDPIYDSKAPNASN
LKIVRMDRTAGCVSGGEEVYLLCDKVQKDDIQVRFYEEDDSGLTWEALGDFSPTDVHRQF
AIVFKTPKYRDQNLQKPTSVFVQLKRKSDNETSEPKPFTYHPQVIGSDKEEVQRKRQKTL
PNFHDFLHRGGGPGAGGPGSAGGGGGSGCPGSDAHHLSFSPPGFFQGFTTYKNTVRRTSG
RQRGKPQVPFLGGAVSSDEDGDPEDGSGSAPRRKARPGIGSGGAAKEGLDPCGGAPSHWL
DPRPPETAGAVLEVTSGQVEALFRYSVTGEAAHLLATQRSLMDAQDEDGDSVLHLAVLHH
QQEVLKSLVQVLSLLPGQDVLNARNHLYQTPLHLAVLTQQREAVQALLLAGADPTLADRH
GNTPLHLASQQGGDGGMVGFLLQDEGMRGLLELPNRAGLCPIHLAVLANQLSSLRELLEG
GANVESQERSCGRSALHLATERDNVSLAGCLLLEGNANVDSCTFDGSTPLHVAAGRGSAK
LTALLVAAGADPRKENFEPLFFLQTSWLQSDKEEGYVPGTTPMNIAATKQQVVELLNGKE
YEPKPSLREPKPPPESDLVSLGLQVKQQVCQALEREALWERLAQALGLGILNTAFRLSPV
PARTLLDSYEVSGGTVSELLAALRSLGECQARSILEGAL
Download sequence
Identical sequences H3CAH9
ENSTNIP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]