SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005263 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005263
Domain Number 1 Region: 657-685
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000602
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005263
Domain Number - Region: 12-50
Classification Level Classification E-value
Superfamily UBA-like 0.0434
Family CUE domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005263   Gene: ENSTNIG00000002705   Transcript: ENSTNIT00000005409
Sequence length 686
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:53952571:53957055:1 gene:ENSTNIG00000002705 transcript:ENSTNIT00000005409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGTHHIDIQVLHDLRQKFPEVPEGVVSQCVLQNNNNLDACCEYLSQVSPVYLYSEEGN
LSFSDGHAPSRLRNHMTQLNLGLPSQNVHVAPSRDSLRMNGSRTLSHSLSEGPLPSGGAG
GDFLQPEPQSAPVQLHPGLGVFGPAEPPRKPQPPQHLGLLPPGVKASSGAAQPAPRFNPI
TVTLAPNIQTVRNTPTSLHIHGGPQSGLSSPLGNSIYIRPFVSQSGSSRLSQQQGGRAQY
SPTSQPQAQQPPQPGWLVGGPPSTAPRIPQRSTNQGHQTSHVYMPISSPTNPQAPSVLPT
GSQASPSVSQFNIQNISTGPRKNQIEIKLESPQRQLLQHQHGCCCAPAAAPGVPTAPLST
GGAGLSRSQPTVYISASPDGAVAPAGSRSQPKFYISANASNDEGGPRNPPTVYISANPPR
AGTSGPRNMAGQVSMGPAYIHHHPPKSRSSVGAGGTASPRVVVTQPNTKYTFKITVSPNK
PPAVSPGVVSPTFEPNNLLGLPPEHHRVEPEPLHLSDPLSPRRERPPSQGRRLSTGSEDA
AYTQAALLVHQKARMERLWHELEHLSRRRLERSTSTSQIPSVEDMKQLRCRNRLLLIDID
CLTKEIDLLQTRGPHFNPGAIHSFYDNIGFLGPAPPKPRVTPPGGKAAPEQQQEEEEEGA
QWSCTACTFLNHPALNRCEKCEFPRL
Download sequence
Identical sequences H3CAJ1
ENSTNIP00000005263 ENSTNIP00000005263 99883.ENSTNIP00000005263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]