SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005284 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005284
Domain Number 1 Region: 371-565
Classification Level Classification E-value
Superfamily vWA-like 2.62e-54
Family Integrin A (or I) domain 0.00056
Further Details:      
 
Domain Number 2 Region: 787-972
Classification Level Classification E-value
Superfamily vWA-like 3.4e-52
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 3 Region: 980-1173
Classification Level Classification E-value
Superfamily vWA-like 2.09e-51
Family Integrin A (or I) domain 0.00034
Further Details:      
 
Domain Number 4 Region: 23-212
Classification Level Classification E-value
Superfamily vWA-like 1e-50
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 5 Region: 586-770
Classification Level Classification E-value
Superfamily vWA-like 5.5e-50
Family Integrin A (or I) domain 0.00076
Further Details:      
 
Domain Number 6 Region: 1757-1950
Classification Level Classification E-value
Superfamily vWA-like 1.63e-29
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 7 Region: 1970-2146
Classification Level Classification E-value
Superfamily vWA-like 5.75e-26
Family Integrin A (or I) domain 0.0017
Further Details:      
 
Domain Number 8 Region: 220-354
Classification Level Classification E-value
Superfamily vWA-like 8.48e-26
Family Integrin A (or I) domain 0.0024
Further Details:      
 
Domain Number 9 Region: 1191-1394
Classification Level Classification E-value
Superfamily vWA-like 0.000000000188
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005284   Gene: ENSTNIG00000002726   Transcript: ENSTNIT00000005430
Sequence length 2180
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54214616:54227540:1 gene:ENSTNIG00000002726 transcript:ENSTNIT00000005430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRRSLLLILILAAGFYGNAAQQTECTTATVADIVFLVDGSSSIGPSNFQEVRLFLRSL
ASGLNVSPDNIRIGLAQFDEPHQEFLLKYHIEKMNLLAAFESFPYRNGGTETGKAINFLR
KQYFTKKAGSRADQRVPQIAVVITDGDSTDDVVVPARELRKHGVIVFAIGVGNANQGELK
SIANRPSERFKFTIDSFQALKRLTERLLETMCVSMEDQHQDVFILLDGGITQAEFRQIRT
FLGSLVNQLNFSPSTYRLGLAQYGQDIKVDFLFKDHQTNKDLLTAVKNAQQRKLQPNEPR
NLGKALQYAYKNFFTPEAGSRNDQSFRQYLVVLTGKDADDPVYEEARRLQTRGHVGTLNS
RPLHLELISFYHFCFFPDCKAANIADIVFIIDESGSIGSSDFQLVRTFLHSLVSGLEVSP
NRVRVGIVVYHGEPKAEVFLNTFTDKSELLDFIRILPYHGGGTNTGAALNFTQHQVFVRE
KGSRIELGVQQVAVVITDGRSQDDVSTPAANLRAGVTVYAVGVKDADEAQLHQIASYPTK
EHTFTVDSFSKLKTLETSLQRVMCQNVIQQAFSASSVKSLDVLFSGCVETEEADIFFLID
QSGSIHPPDFYDMKKFILEFLQTFRVGPNHVRIGVVKYADSPTLEFDLHTYTDVKSLEKA
ITNIHQVGGGTETGKALDFMRPQFDRAVTTRGHKVKEYLVVITDGNSTDKVKDPADKLRA
QGVVVYAIGVKDAVEKELLEISGEPQRTFYVNNFDALKPIKDDIITDICSTDGKSCRNLC
GSCLKQHFLVCKDVPGDLIFLIDSSGSIYPEDYQKMKDFMKSLVQKSNIGKDQVHVGVLQ
YSTEQKLVFPLIQYYTKDQLSKAIDDMQQIGGGTHTGEAIAVVSKYFDAQNGGRPDLKQR
LVVVTDGESQDDVKLPAEALRAKGVIVYSIGVVAANTSQLLEISGDADRMYAERDFDALK
DLEKQMALEICDPDRGNPFIPAPAPVRPVCEKQKADLVFLLDQSGSIQSDDYTTMKKFTI
DLINKFQISRDLVHVGLAQFSSTFKDEFYLNKFFDEQAISAHIKDMQQEEGGTLIGLALN
SIRKYFEASHGSRKAEGISQNLVLITDGDSQDDVEEAARLLRGLGVEVFAIGIGNVHDLE
LLQIAGTPENVFTVKNFDKLEGIHQKVVDTICQSKPIPDPSRPNGTHLVAGCSIDIAMGF
DISRRSGAPGETLVSGHAALRNFLLEIADYVSSISGLCCTDSKPVQTNIGYRVVRQDGST
LYDFNFEPHSSEVVKKVMTSSVATPTSFNTALLKSFQEKFRQSQGLVLVIFSDGLDEDVI
KLEEESERLRLSGRVSALLLVALEGTSLGQLQMVEFGRGFGYKVPLSISMPSVGSTILKQ
IDMVSDRECCGVMCKCSGHEGVRGLRGSPGSKGVTGQQGYPGFPGEEGVAGERGRPGPSG
PQGVQGCSGPRGLVGNRGLRGNRGENGEDGLNGVDGEQGDAGNDGSRGERGHAGNPGIPG
IRGEAGLKGERGLRGDPGEPGTRNTVQGPKGDPGSPGLPGPTGMDGEPGKDGANGQQGPD
GRRGPPGEKGFTGKPGDAGPPGLPGASGPVGSRGNKGDTGPPGVAGLPGPQGGPGPAGNP
GASGRRGVVGPKGQPGEPGQQGVPGPQGPRGLPGQDGKDGYGPAGPGGVKGDPGFPGYPG
LVGENGLQGPKGTPGPKGNQGQPGKAGPAGESGLSGEPGYAGHRGPRGPPGKPAMTECQL
ITYIKDNCACSSHHPRCPVYPTELVFGLDMSQDVKPADFQRQRAALLSLIEDIAVSESNC
PTGARVAVVGYSSYVKHLVRFQDYRRKEQLLEFVKNIPLERSGNSRRLGGAMRFVGHNVF
KRVRAGAVTRKVAVFFSNGLTQDDGDLVAAVMEYRGLGVVPAIVSLKNAPSVSRALELDD
SGNAIFSVLGRDAVASLQKVKDCAICYDPCQRSQQCSFIQEKLGPQEANLDLALVVDGSR
EVQADQFAGIQQLLGSVVEQLAVSPQPRKPGDQARVAAIQQSSAQVQAEFGLQVYQNHKL
MRRHLVQNMQQQAGSSALGHTLDFALNQVLLKASHPRQRRVLFAVVATQTAQEDAAQLRY
VAQKARCEGVALFVVTVGNRYNRTEVEEIASTPLPQHLVHVGGMKADEQAYICRFFRVFV
NALNMDINTYPPPSLKASCD
Download sequence
Identical sequences H3CAL2
ENSTNIP00000005284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]