SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005285 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005285
Domain Number 1 Region: 8-128
Classification Level Classification E-value
Superfamily vWA-like 6.85e-31
Family Integrin A (or I) domain 0.0025
Further Details:      
 
Domain Number 2 Region: 712-905
Classification Level Classification E-value
Superfamily vWA-like 4.75e-30
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 3 Region: 146-349
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000565
Family Integrin A (or I) domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005285
Domain Number - Region: 908-956
Classification Level Classification E-value
Superfamily vWA-like 0.0241
Family Integrin A (or I) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005285   Gene: ENSTNIG00000002726   Transcript: ENSTNIT00000005431
Sequence length 956
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54215513:54226933:1 gene:ENSTNIG00000002726 transcript:ENSTNIT00000005431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLKYHIEKMNLLAAFESFPYRNGGTETGKAINFLRKQYFTKKAGSRADQRVPQIAVVIT
DGDSTDDVVVPARELRKHGVIVFAIGVGNANQGELKSIANRPSERFKFTIDSFQALKRLT
ERLLETMCVSMEDQHQGPNGTHLVAGCSIDIAMGFDISRRSGAPGETLVSGHAALRNFLL
EIADYVSSISGLCCTDSKPVQTNIGYRVVRQDGSTLYDFNFEPHSSEVVKKVMTSSVATP
TSFNTALLKSFQEKFRQSQGLVLVIFSDGLDEDVIKLEEESERLRLSGRVSALLLVALEG
TSLGQLQMVEFGRGFGYKVPLSISMPSVGSTILKQIDMVSDRECCGVMCKCSGHEGVRGL
RGSPGSKGVTGQQGYPGFPGEEGVAGERGRPGPSGPQGVQGCSGPRGLVGNRGLRGNRGE
NGEDGLNGVDGEQGDAGNDGSRGERGHAGNPGIPGIRGEAGLKGERGLRGDPGEPGTRNT
VQGPKGDPGSPGLPGPTGMDGEPGKDGANGQQGPDGRRGPPGEKGFTGKPGDAGPPGLPG
ASGPVGSRGNKGDTGPPGVAGLPGPQGGPGPAGNPGASGRRGVVGPKGQPGEPGQQGVPG
PQGPRGLPGQDGKDGYGPAGPGGVKGDPGFPGYPGLVGENGLQGPKGTPGPKGNQGQPGK
AGPAGESGLSGEPGYAGHRGPRGPPGKPAMTECQLITYIKDNCACSSHHPRCPVYPTELV
FGLDMSQDVKPADFQRQRAALLSLIEDIAVSESNCPTGARVAVVGYSSYVKHLVRFQDYR
RKEQLLEFVKNIPLERSGNSRRLGGAMRFVGHNVFKRVRAGAVTRKVAVFFSNGLTQDDG
DLVAAVMEYRGLGVVPAIVSLKNAPSVSRALELDDSGNAIFSVLGRDAVASLQKVKDCAI
CYDPCQRSQQCSFIQEKLGPQEANLDLALVVDGSREVQADQFAGIQQLLGSVVEQL
Download sequence
Identical sequences H3CAL3
ENSTNIP00000005285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]