SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005362 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005362
Domain Number 1 Region: 26-231
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.02e-57
Family BAR domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 588-661
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000147
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005362   Gene: ENSTNIG00000002801   Transcript: ENSTNIT00000005508
Sequence length 662
Comment pep:known_by_projection chromosome:TETRAODON8:15:511106:520320:1 gene:ENSTNIG00000002801 transcript:ENSTNIT00000005508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEQVVINFRRQESEGSRLQREM
KAYMAAIKGMQQASINLSQSLHEVYEPDWHGKDDVLSIGKDCDALWEDFHNKLVDSTLLN
LDAYLLHFPDLKGRVAKRSRKLIDYDSARHHLETLQMSGMKNDRKMMKAEDELKKAQQVF
DELNGSLQNELATLWDSRVNFYISTFKSVSRLEARFHREISVVCRQLYEVMTKLAEQHSD
KVFTIQGAPSDSGPVRLAQTPSPPEDESPPDSPDAGFNHSVRPVSPRPPRPKSPPQLKKG
PPVPPLPKVTPTKEVAEEQIIDFFGGEFLPAPSPLQVPNERPGQSLLDLDLDAFQPDESV
SPIPQVTSQVTSQTAVPWDMYWSADFGEAVPGAGSSAAGLEGDQDGAQSGLHLEAGTAAP
QEGGAAPSAEGENEAEAEAADVPPPAGEEEEAGAPTAEEEPTADPSVDEEADALCPVFSV
QVPAEAPPSEEAELAEVPVRTGSAASSGHQWSDLFDLLQVPADPCAEAAPQENMSIPSVI
IEPASSNEGDDDRDGDIISPTAAGDNHVTTAGQPMKHMGASGGGAQLPEDFLFKVETMHD
FEAANSDELELKRGDVVLVVPTESLEDQDAGWLTGIRESDWLARGASAQKGLFPENFTQR
LE
Download sequence
Identical sequences H3CAU0
ENSTNIP00000005362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]