SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005383 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005383
Domain Number 1 Region: 328-466
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-22
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 
Domain Number 2 Region: 549-681
Classification Level Classification E-value
Superfamily PX domain 1.7e-20
Family PX domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005383   Gene: ENSTNIG00000002820   Transcript: ENSTNIT00000005529
Sequence length 925
Comment pep:known_by_projection chromosome:TETRAODON8:14:9645960:9650587:1 gene:ENSTNIG00000002820 transcript:ENSTNIT00000005529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLFTSLKRRFKIDVLREAGRQYPVFCFLMLSLVSLTVLLNSYIHVLMVFWSFLAGVAT
FYCSIGPQTLLPSIFFSIKAKKQEQQQELFPLGSSCAVCGKLKCKRHRPTLLLENHQPWL
GLKHSKVDASVAEVFDLVLENFVYPWYRDITDDEACIDELRMTFRFFASVLLRRAQKVDV
PAVCADKVLKAALKHVEIIARARDKVASAEGLQQAALEEYGADLHVALRSRRHERLYLRR
LTEMLFPFLMPPKATECRSLALLLREVMTGAVLLPTLDFMADPPLLAGRVLTLEVHRRGP
QEGVGEWRRRPSVLQRTPLMAAVAPQVLKLELKDIRAQQDLLFRFMSFLKREGAVHVLQF
LLTVEEFNDRILQPELSEGELQRLHAEVLHIYRTYCLDQSADKINFDRFILEEIRSVAEG
PGRDVVKLQTMRCLFEAYEHVLALLERVFTPMFCHSDEYFRHLLMGAEGPARSSRSSRPR
VPPRDRNWSRRGDALAISRIGSRIKGVFRSAAVEGAVPPPSGPSHPDQDPVEEAAAVVED
DGPAEPASEAGRQRNLAAWSVAIPDVRSYDDELKRDKVLVFCIRVERNDRTQAGHQAERW
TVYRRYPEFYVLESRLTQFHGTFEDAQLPSRRLIGPKNQEFLVSKREEFQEYLQQRLLQH
PELSNSQLLADFLSPHSEESQFLDRTLVDVSLGRIFKSVPGKLMKEKGQNLEPFIQSFFN
SCESPKPKPSRPELTVLSPSALSDRKLFNDLFKNNAGTPDGPDRKRTCATFMQVAPVDGV
YDSMMFMARTVFRVPAWLHHVLAAGRILLKNTLEAYMQQHMRSKLEQVLQEHRLVSLITQ
LRDAVFCEGGAQRSLQERHARARQTFQEMLRYLPEWLVRGLGEEGNSQGIRLLFEGLQQP
LLNKQMTYVLLDLAVQELFPELSKV
Download sequence
Identical sequences H3CAW1
99883.ENSTNIP00000005383 ENSTNIP00000005383 ENSTNIP00000005383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]