SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005395 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005395
Domain Number 1 Region: 396-637
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.99e-73
Family Eukaryotic proteases 0.00096
Further Details:      
 
Domain Number 2 Region: 151-240
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000942
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 
Domain Number 3 Region: 280-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 65-121
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000582
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 5 Region: 246-278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005395   Gene: ENSTNIG00000002830   Transcript: ENSTNIT00000005541
Sequence length 646
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54448333:54574829:1 gene:ENSTNIG00000002830 transcript:ENSTNIT00000005541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGHESWQATPPSPSPPPSPSPPASPSPPPSPSPEGGAEPDPDPVLGPPECLQRGYTRR
SCDRVFCPPWQRCLDGECLCKLPYQCPVDNVTAVCGRDHRAYRSYCQLMALSCRTRTPQF
SHFGDKCEDTFSSAILPGSGAIRLLLPSAPGGSSVLVCWRLWDMAAANVVCREHGHLLPP
AAVTFIPYPSLKTTDQSLPGSCVTSRCQGYENSLAECIIYDSMRIGSRKVATVSCYDASQ
DTSEDDNRFGCVNGKRVSLNQTCDGVDDCGDRSDEMCCQSCRNKGFRCRSGVCLHKDALR
DGQQDCLDGEDEASPDRALISANTETPAPTAGRPGNQARTLRQPDSLGSEGHARHLLPSK
HLSPKQELLANRRFLESKVSCGLPNMDVLHDEDVKARGRHKRVVGGVPAKPTQIQWQVAL
EENRKIDCGGAFIGGCWVLTAAHCVRPRPSAFRVKFSLWKKFRSQNTTDIVPVKDIIIHP
RFNASTYENDIALVELRKLPFRDACFEDNPAIRAVCVPWTAQLFQPNHTCSISGWGRTSD
GGRASQVLQWANVSLIGDCQRFYGERLKPGMTCAGDLDGSVDSCQGDSGGPLVCQDQLGV
SYLWGIVSWGERCGRSGFPGVYTQVADYFEWIRRQTGWLAVTRFNS
Download sequence
Identical sequences H3CAX3
ENSTNIP00000005395 99883.ENSTNIP00000005395 ENSTNIP00000005395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]