SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005417 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005417
Domain Number 1 Region: 377-505,691-878
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.02e-45
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 53-126
Classification Level Classification E-value
Superfamily E set domains 0.0000000105
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005417
Domain Number - Region: 175-228
Classification Level Classification E-value
Superfamily E set domains 0.0157
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005417   Gene: ENSTNIG00000002851   Transcript: ENSTNIT00000005563
Sequence length 911
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54783521:54793186:-1 gene:ENSTNIG00000002851 transcript:ENSTNIT00000005563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPCHKVSKVTGKAQDTTTGPQGSSNQTGGVVVRVLFGKAERAIGSVRFRYLDDPVITEA
SPAESFYAGGRVVMVTGRNLDVVQRPVLAVWVEPVEVQRMTCRTPRVTPDLKIKGVWFQM
DNVRIHFKSIIVTDDLISISVADGSVCLSASQGQSFSYFPNPEFFPLNREAPNAPYRFKP
GGVIAVEGQHLTRAISRHEVTARLGDEECEVKTLDHTHLYCEPPEIQPASADGGELPSLK
VFMGSLQVDLGPVQYDSDSLLSPVPLAAQISLAAVAAVIILSVLVVILMRKSKQALRDYK
KVLLQLETLEINVGDQCRKEFTDLMTEMMDLSSDVGGPGLPLLDYRTYAERVFFPGQHVA
PLTRQLDLPESRRQTVEQGLQQLNNLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTM
ALHDKLEYFTEVMKTLLQDLVQQYVAKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEVA
GEPLYMLYRAIKYQVDKGPVDSVTGKAKRTLNDSHLLREDIDYSAMAQTLMVKNGVEVQT
CPVKVLDIDTITQVKDKILDQVYRGAPFSQRPAADSLDLEWRSGQAGHLTLSDDDVTAVV
HGRWKRLNTLQHYKVRSSDGATVALIPRSQSSGGVGVNQVFQTGEKTPMLEGEEEEGLRL
WHLVKSSEDPDIPKHRKSSMRDRERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILSTKR
PPPIAVRFFFDFLDDMAEKHGIDDPETVHIWKTNSLPLRFWVNILKNPQFVLDVQVSDSM
DAVLSVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQLVERYYSDIHSAASGCYQ
EMNSTLTELSGQSFASEMNNLVALHELYKYINKYYDQIILSLDEDSSGQKMQLAYRLQQV
AALVENKVTDL
Download sequence
Identical sequences H3CAZ5
ENSTNIP00000005417 ENSTNIP00000005417 99883.ENSTNIP00000005417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]