SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005432 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005432
Domain Number 1 Region: 114-335
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.92e-44
Family Ankyrin repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 555-652
Classification Level Classification E-value
Superfamily PDZ domain-like 6.66e-19
Family PDZ domain 0.0000156
Further Details:      
 
Domain Number 3 Region: 446-522
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-18
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 1452-1521
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000107
Family SAM (sterile alpha motif) domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005432   Gene: ENSTNIG00000002866   Transcript: ENSTNIT00000005578
Sequence length 1525
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54902767:54910210:-1 gene:ENSTNIG00000002866 transcript:ENSTNIT00000005578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPPSGSSIVVRIGIPDLQQTKCLRLEPELPVWTSKQRVLVTLTQSLSDVLNYGLFQPAFN
GRAGKFLDEERLLKDYPLPPITPIPYLEFRYKRRIYTQSYVDDKQLAKLHTKANLKRFME
HVHQKNVEKVSKWLEKGLDPNFHDSDSGAECPLTLAVQLEESSELIKVLRNGGAHLDFRT
RDGITALHRAVLCRNSASLTTMLDLGASPDYKDSRGLTPLYHSAIVGGAPYCCELLLQDH
ATIGMTDENGWQEIHQACRHGNVQHLEHLLFYGADMSSQNASGNTALHLCALYNQDGCAR
VLLFRGADKDVKNYNNQTAFQVAIIAGNFDLAETIKIHKHSDVAVPFRESPSYTKRRRLG
LGWTPAGNGLSSPRSLIRSASDNALESPASSPGPSLQSLETSHDTHTLAAPTHAPSQVRP
GSAALDPLPVPVSDSGLSSDSPPSLPPLTPQMRKRRLYSAVPGRTFIATQSYVPQGSGEI
QLHRGERVKVLSIGEGGFWEGSVKGRTGWFPADCIEEVQMRQYDPRLETREDRTKRLFRH
YTVGSYDNYTSYSDYVIEEKTAILQKRESEGFGFVLRGAKAETPIEEFVPTPAFPALQYL
ESVDQGGVAWRAGLRTGDFLIEVNGSDVVKVGHRQVVSLIRQGGSRLLMKVVSVSRKSES
NLVRKKAPPPPKRAPSTSLTLRSKSMTADLEEISAARRRRIEKLDEMLAGGQEVVLRPRP
PEDFRAATVKQRPTSRRITQAEINSLFERQGVAPTTGPEKATMAVTARKCHRTKTFGTPE
DDRISALINESRFPRSSSLTDSFIPPPPQTAPPPPPVDSGPPPSFLPPPPPSRAEALSRS
SFKPGAEPRLQELSDSPVRSHAHAERQRKARSMIILQDSPPALQADTHASVLAVHGASPA
LGHSPLSRRRGRPIENPYANVGQQAPPSKPQRRKSPLLKQPPVEEQGEPSTFDVCLSGVG
IKDPDASKLEPPSSPSRAELYQQHMLSERARVQARRSSLFLSVEGSASESQAPPLLSQSH
SMDDLGELPPPAPVLSPSPTPHTFLHPLTGKPLDPASPLALALAARERALTARTPSPEPR
LKHASGAATPVPTPAASPEGRHKRTPVATPQSSPEPRSKRTTPQSSPEQRTKRATPQSSP
ETRHKRMSPPLFPDGQVERPETEGGVTSPAGPSPERWTDRRRSLTVGSSEEEGGAYTVTL
PPALLSSSDEETREELRRIGLVTPPPAFTNACAPPPGFWRCCRGAGAARLRDPLLKQSSD
SGGSRQPRYLFQRRSKLWGGGDEERRGSNAEEAGGRPAALGGQASGLDLANRLQLLNKDS
HSLGEEPSSLDPGRRSPVGGARCLFSSLGELHTISQRGYGASYTVRPGSRYPLSRRSPSP
SPSPSERPDLGSSRALTILKSSSLSLPSEPKEVRFVMRRLAPRARSRSPSPSPHASPCPS
PVLSGPLLALRPWRQRPLTLWNKYDVGDWLESVGLAEHRQRFQEHEIEGSHLPALTKEDY
LELGVTRLGHRINIERALRGLLDGS
Download sequence
Identical sequences H3CB10
ENSTNIP00000005432 99883.ENSTNIP00000005432 ENSTNIP00000005432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]