SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005442 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005442
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.64e-20
Family PB1 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005442   Gene: ENSTNIG00000002876   Transcript: ENSTNIT00000005588
Sequence length 420
Comment pep:known_by_projection chromosome:TETRAODON8:2:10741978:10747564:-1 gene:ENSTNIG00000002876 transcript:ENSTNIT00000005588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGQLDLSGKLIIKAQLGDDIRRIPIHNEDITYDELVLMMQRVFRGKLQSNDEVTIKYKD
EDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNNLL
DTLEPPTEPGLTATAPESESVDGREGKVVAADPTVKQATPVSAASMSAFDPLKNQDEVNK
NVISAFGLSEDQAPVAHPAVAAEERSATPDSIASSSSAAPQPAVAPQPQAPYPGVQQGPP
SAFVGQVYQQYQAPGGYPPQQPGAPPQPQQQQQYGMQYSASTGYSTQPGAPQPGPPQPQQ
QQQFQNYAPPSSQAPAPAPGPGPAPAAGFQGAQQQPHPSQGAQQYPPGAYPPQNYTSQAS
QPANYSLPPSSQPGSGYQPRPGYTPPPGGAGTPPPGVANPYARNRLQYSQGYTQPGPGYR
Download sequence
Identical sequences H3CB20
ENSTNIP00000005442 ENSTNIP00000005442 99883.ENSTNIP00000005442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]