SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005444 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005444
Domain Number 1 Region: 245-400
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000353
Further Details:      
 
Domain Number 2 Region: 35-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 3 Region: 143-242
Classification Level Classification E-value
Superfamily LCCL domain 4.05e-24
Family LCCL domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005444   Gene: ENSTNIG00000002878   Transcript: ENSTNIT00000005590
Sequence length 675
Comment pep:known_by_projection chromosome:TETRAODON8:2:10771882:10779917:1 gene:ENSTNIG00000002878 transcript:ENSTNIT00000005590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPTGAGAPLLSILIILTAEGCRAQKGDGCGPSLLGPVSGTLSSLGYPGTYPNGTVCEWEI
SVPPGSRIHFRFAELDIENPNCQVSYLGLYDGIGPKRSVIAKYCGLKVKEFINSTGNQVT
VQFMSGTHHSGRGFYLSYSTTEHTDLITCLDKGSDFPEAEFSKYCPAGCLTSTEGISGTM
PKGYRESSPLCVAAVHAGVISNAVGGRISVVNSKGIHHYEATVANNVTSTGGSWSNSLFT
FRTNGCYGKLGLESGVVADAQLAASSVSEWNGSVWAPSGARLKKPPPSWLAAQSDDQQWL
QVDLKREKRITGIITTGSNWRECQYYVSAYRIHFSSDGEQWQIYREANSSQDKIFQGNIN
YMDEVRNNFIPPIEARFVRVNPTQWHQGIALKLELLGCPIHVATRSFVLTVLPNPRSRSS
SPSHHSPPSARTRRPPLGGQTTPPPDIRNTTVPPQGGKDVALATVLVPVAVTVVTALVLT
VVCARHWKNRKKSSEGTYDLPHWDRTDWWKSMKQLLPSKMVEAEDTVRYSTSGVGRLAGR
GAVPRIHAEPAEYAQPLVSGVTTLGARSTFKPDEGPEPGYSDPDLYDKPISPDVYHAYAE
PLPASGSEYATPIVVDMGLSQPCAFSGTAALLARTDSGQSGRSSYDTPKNANGQATPTED
LTYQVPQSSTQKPSG
Download sequence
Identical sequences H3CB22
ENSTNIP00000005444 99883.ENSTNIP00000005444 ENSTNIP00000005444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]