SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005449 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005449
Domain Number 1 Region: 330-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 439-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000177
Family EGF-type module 0.032
Further Details:      
 
Domain Number 3 Region: 386-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005449   Gene: ENSTNIG00000002883   Transcript: ENSTNIT00000005595
Sequence length 471
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54954352:54962600:-1 gene:ENSTNIG00000002883 transcript:ENSTNIT00000005595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TITTVLLFLPLLAQGQFDVCRSLRDSEGGPGWEFYACQPSPSNMKEVMQIRVDPPGITCG
NPPERFCTLENPYLCSDECDASSPDLSHPPQLMGDRERGGLITYWQSVTWSRYPEPLLAN
ITLSWNKSLELVDDITLTFEYGRATSMVLEKSLDKGENINVWPKTINDLREVYIFKAERI
ETQSSSLSYEPMIQFIFASRSIITFAEQIIKLNKRIHFSSLTTEFAESDQLPTETLPNKF
LPDIIPPPDSPLITLSPTQSPLYIIRPNVPLPDKPLPNISQINQFAEFCSLQMQKSTSNC
NDFAPECRLCPFIYAIISFVFFPPVSFPDCECNDHSSRCSYIDFINVVTCVSCKHNTRGQ
RCQYCRLGFYRNASLPLNDENVCAVCDCDEERSVSPHCSDDGACQCKPGASGRRCDSCLP
GYTWRANGSGCTEKVCDEESLMCQNGGTCIDFQRCICPDKFTGVFCEESIC
Download sequence
Identical sequences H3CB27
ENSTNIP00000005449 99883.ENSTNIP00000005449 ENSTNIP00000005449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]