SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005459 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005459
Domain Number 1 Region: 220-367
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-23
Family SPRY domain 0.0064
Further Details:      
 
Domain Number 2 Region: 38-150
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000321
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005459   Gene: ENSTNIG00000002893   Transcript: ENSTNIT00000005605
Sequence length 383
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:54996970:54999137:-1 gene:ENSTNIG00000002893 transcript:ENSTNIT00000005605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAFRLSTRLAASENMSQYTVDFSAERAGLQRLHFLPVPRAPEISASGCLVCDNALTVS
WRPASEANSMEDGPADGPAEHYELEYRKTNGSSTVTAAGGACWEKIQEIRDTQVTVSGLK
FDSDFIVVRVRARNKTAAGEFSEPVALETKAFNFGFDLLTAHAELKVHGDTVTWEPQGVK
GHDPRLRGKENKNVKTSDLNFVSSRSATPSPSKTPANRAGRERFTGDSYTVLGDQEIAGG
CHYWELRPVLDWKSFSVGVAYRASLGRFDQLGKNGGSWCLHASQWLQTSLSVKHNNRAKA
LDWPLPQRIGIYCDGGNGIRTRDLIFIDVDRLRLLHAFKTKFNQPLVPAFTVWCGGITVT
TGLQVPSFMGNFLSTSRSLSSLS
Download sequence
Identical sequences H3CB37
99883.ENSTNIP00000005459 ENSTNIP00000005459 ENSTNIP00000005459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]