SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005477 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005477
Domain Number 1 Region: 575-687
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00025
Further Details:      
 
Domain Number 2 Region: 66-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-30
Family G proteins 0.00000208
Further Details:      
 
Domain Number 3 Region: 331-395,515-562
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000444
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 738-796
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000553
Family Ankyrin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005477   Gene: ENSTNIG00000002909   Transcript: ENSTNIT00000005623
Sequence length 829
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27835181:27848508:1 gene:ENSTNIG00000002909 transcript:ENSTNIT00000005623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSKSANSAAIKGEIKRHDSLQNTINRLSKQLERVPDQQLRAGLKVYLHSIQVNLANSQE
WTLSRSIPELKLGILGNLKSGKSALVNKYITGSYVALEKPDGGRYKKEVLVDGQSHLLLI
REESGSPDAQFCSWVDAVILVFSLENEASFQDLYQLYSQLSSQRADIPVIVVGTQDKISS
GNPRVIEDQRARQLCIDVRNSLFYETCATYGFNVDRVFSEAAQKIVAQRRQVALQACKSL
PNSPSHSGGSTPGSASFPGQTSNGPSGGYICSLPSTPVVSHRELRVAQGEAGGSITSRSL
KNIPRRPSLFKNRDSEKKAAEGKGEAGAMRGVPIKQSILWKRSGSSLNKEWKKKFVTLSN
NGSLSYHSSANDYTQNIHGKEMDLLRVTVKVPGKRPPRAVAPAGPSPVPAGSGPGVNGLT
AADSTGAVPPTAPQACSTTPSAVDERAGPERALQRCPSSLSAKAQSVDGLEGGAGPFSGK
DPCQSSPMSDRKKNRRKKSMNQKGDAAAGQAEDEENADFIIVSFTGQTWHFEAQSLEERD
AWVSAIESQILASLQSCESGRNKARRSSQSEAVALQAIRNTKGNSLCVDCEAPNPTWASL
NLGALICIECSGIHRNLGTHLSRVRSLDLDDWPGELTQVLAAIGNHMANSIWESCTQGRT
KPAPSATREERESWIRAKYEQREFVAPLQPTQGTPLSEDGMPAWLLCAVTDRDLPRLLLL
LAHSTKEQINGAQAGAPSLPRTALHAACQLGDVVMTQLLIWYGIDVRARDHQGQTAMRIA
RKSASRGCMDILLQHDCPSESSPPTTTPILSRRSSTASLGRTSSRKRVS
Download sequence
Identical sequences H3CB55
99883.ENSTNIP00000005477 ENSTNIP00000005477 ENSTNIP00000005477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]