SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005482 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005482
Domain Number 1 Region: 241-334,389-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-17
Family SPRY domain 0.031
Further Details:      
 
Domain Number 2 Region: 43-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-16
Family SPRY domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005482   Gene: ENSTNIG00000002915   Transcript: ENSTNIT00000005629
Sequence length 432
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:27879375:27905329:1 gene:ENSTNIG00000002915 transcript:ENSTNIT00000005629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRDTKKHRLLNIMDDVSVLQHRCLLNLERRIRDFGQDRPAEERCVRLQKDGDTLSYQGNS
EEVGCYMAGHPLSRGNRYFEVTIVDTGVRGTIAVGLVPKFYKLDHQPGWLPYSVAYHADN
GKLYNGDPVGQQFGPKCSQGDRIGCGIHSENVEAGITTVFFTKNSQEVGFAEVPLSVEGL
FPAVGMHSMGEEVKVDLQAKWHLEEDESMMMVDSHEDDWGRLHDVRASGTLLEYVGNGKS
IMDVGLAQARQPLSTRRHYYELEIVDAGEKCYIALGLARRDYPKNRHPGWSRGSVAYHAD
DGKIFHGSGVGDAFGPRCFKGDIMGCGIMFPRDYILDGEGESDDWEQSGGRLASTDGGMS
NIPYLPDEEEEEDDVADVEQGQERGKVTVFFTRNGKLMGRREMVVPPGGLYPTVGMLSSG
EKVKVDLQPLSG
Download sequence
Identical sequences H3CB60
ENSTNIP00000005482 ENSTNIP00000005482 99883.ENSTNIP00000005482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]