SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005520 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005520
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.93e-23
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 420-491
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-21
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 359-426
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 156-231
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000446
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005520   Gene: ENSTNIG00000002952   Transcript: ENSTNIT00000005667
Sequence length 1094
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:55511876:55522222:-1 gene:ENSTNIG00000002952 transcript:ENSTNIT00000005667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEMLLQHQSNPCIKNKAKKTPLDLACEFGRLKVCQCLQTINNSQPLLLLQSVCLGVCPNS
IIPLFLNARLGMLKLSRLLLEAGIDMNRVTKTGTCLHEAALYGKTEVVRLLLDAGINVNI
RNTYNQTALDIVNQFTTSTASREIKQLLREASSSLQVRAVKDHWNQHDAMALNLRCGDIV
TVLEQNSDGHWKGHIHDPQKGIDQVGFFPPSVVEVLSRRAVYPSMELPKASGPFQQHFAS
TPPYSSNGSTLQPGNSCPHDSTGDRSSVGSVGSSRSTGSGQSSESTHNKQNESYLTEMCK
QMAPSAGESVPLTVWHQDIKAQNMRNADAPHIGYSNDQVRDAPHKDFLRSEHLMKGEDSE
AIYQWLSEFQLEQYSSNFIKAGYDLPTISRITPEDLTAIGVTKPGHRKKISMEIARLSIP
EWLPNYIPPDLGEWLSAIGLPQYQQRLCDNGYDSITIVKDITWEDLQEIGITKLGHQKKL
MLAVKRLCDLQRSHNHPDKTGGGPLQQNPPTALELVAIEHNVLRHIQSETPSDGGCTSPR
TARALLSFQDSELSAELQNAMTGHAGVGGPFDFRGGASAAMSVSQESIGTRSRGSGTSSS
VYPAVPPKSKHVHLPNRLHQPHHTSSSSSSPSSQPSPPPKTYTYIHPCKASTNETPSMQP
SKLPEAVGLPEPQHDQNPTHYDLKGPQKKRTLSLTHFTLSDSEPGIDDDLSTPYASSSVV
VPSYATLSRRAGHGHANAAGLHHRLNRSHSFAVRSRRKGPPPPPPKRMSSVSGVPHGTIA
YVKPVHDRGTGASRRTESERTGESKSQRFGGAEGSLKHDRRPIGESTTASLNPGCTSHFP
FAEEGILTIKQRPRAAAAPEGPAPLLKGLMPPEFNLKESDTVKRRHKPKPSLTPEETPSP
QRENSQPQKGPRPPVSSKPFSPQQQPLTSNPTTPPKSLSASLSGAHTAIPNLTNIQIHTV
SPKLGSSVQTQASKSVLNPGKLGKTVMPPVEKCTALSGKFKRIQDGPAAASFPQGPGSPP
GLPLMNAAQLEALAQRRLEQTSTSLEAALRVVENKLSQDSLDRGSSTVKAAGNILDDIGS
MFDDLADQLDAMLE
Download sequence
Identical sequences H3CB98
ENSTNIP00000005520 ENSTNIP00000005520 99883.ENSTNIP00000005520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]