SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005565 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005565
Domain Number 1 Region: 72-163
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000267
Family Integrin A (or I) domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005565   Gene: ENSTNIG00000002996   Transcript: ENSTNIT00000005713
Sequence length 332
Comment pep:novel chromosome:TETRAODON8:12:584024:596687:-1 gene:ENSTNIG00000002996 transcript:ENSTNIT00000005713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCSGSPKKNTYVQGLGPLLDAAGAPPPDCRRAGELNPNRRSSKWCFLGEILTCMRAFEG
FSIFFPPQASEQIYYGRSKGYRSASVIIALTDGELHEDLFYYAEREANCSRSLGASMYCV
GVKDFNETQLARIADSKDHVFPVNYGFATLKGVINSVSKVVVCSMGASQGTVLSPFLISV
YTSDFRHNSKQCHLQKFSDNLPMYSTEDTYLLCPAPMLQDKGMIAHLYVSMNKGLSFMSN
SFTITTVACSNGIILAIALLFLMLFLILALLWWFWPLCCTVVRWGEKGSTEEGAKLEKAK
NAKVKMPEQEYVPPFSTMACINPPGLASGTHL
Download sequence
Identical sequences Q4TAB1
ENSTNIP00000005565 99883.ENSTNIP00000005565 ENSTNIP00000005565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]