SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005579 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005579
Domain Number 1 Region: 17-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.67e-29
Family Laminin G-like module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005579
Domain Number - Region: 300-493
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0022
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005579   Gene: ENSTNIG00000003010   Transcript: ENSTNIT00000005727
Sequence length 497
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56054181:56064831:1 gene:ENSTNIG00000003010 transcript:ENSTNIT00000005727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQIVQSMGSRGLRLSEGMTTLPSFPASQIFTNCDFFPAEFSLVVTIKTPRLMQKEKEYIF
SVVNEESRLPVLGLRMSENKIHLLVTSGSGGVQRLNFKDVGLDDDRWHTVTLAVTGPYAT
LTIDCGLPLELKQDQSFPSALSTSGSRFFVGSRGRSKGRFSGLLRQLVLLPGSDATVRLC
ANSDPSLAELSIPHILKSKPVHPNNHGHVYSYEAEAKVTLGSPPPCSGPEMGQLWFNVPR
KDLLICDGLTWTTLLQKTERLDYVEDYQDLYTTSETFDIEVFSIPSEGLFMAAANRLSNL
KGSGVYKWRNGSFQPYQNISTREARAWKHFTINSKIFLVVANSREVEPELSVIYQWNVQQ
RRFLHHQTLETHSALDWEAFSIHNHSFLVVANHRRARDSNHNIHSVIYWWNPQTELFEEN
QTLSTSGAYDWEFFSVEAYHFLIVANTFNGRTTTISSTIYVWLNGSFQPFQDIPTVGAAD
WETFQIDGRFFLVVANS
Download sequence
Identical sequences H3CBF7
99883.ENSTNIP00000005579 ENSTNIP00000005579 ENSTNIP00000005579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]