SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005587 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005587
Domain Number 1 Region: 167-227
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-20
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000582
Family LASP-1 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005587
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000183
Family LIM domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005587   Gene: ENSTNIG00000003017   Transcript: ENSTNIT00000005735
Sequence length 229
Comment pep:known_by_projection chromosome:TETRAODON8:3:13588620:13599312:1 gene:ENSTNIG00000003017 transcript:ENSTNIT00000005735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPTCSRCNRIVYPTEKVNCLDKYWHKGCFSCEVCKMTLSMKNYKGFDKKPYCNAHYPKT
QFTTVADTPENLRLKKQSMMQSQVHYKEEFEKNKGKAYSQVADTPEFLRLKKSQEQISNI
RYHEEQSKRKVGDPPLNAPAGYQPPASSQNYHCDPDPEPVRQAAAASPPSSGKRYRAIYD
YAAADDDEVSFVDGDVIVDVHQIDEGWMYGRVERTGQQGMLPANYVDAI
Download sequence
Identical sequences H3CBG5
ENSTNIP00000005587 99883.ENSTNIP00000005587 ENSTNIP00000005587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]