SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005593 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005593
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily vWA-like 1.78e-48
Family Integrin A (or I) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 223-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000301
Family Legume lectins 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005593   Gene: ENSTNIG00000003023   Transcript: ENSTNIT00000005741
Sequence length 316
Comment pep:novel chromosome:TETRAODON8:Un_random:41179856:41182193:-1 gene:ENSTNIG00000003023 transcript:ENSTNIT00000005741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCAGCSTAANDLVYVLDGSWSVGVSDFDTAKQWLINITSQFDISSHYTQVGVVQYSDAPR
LEIPLGKHQGQDELIRAIQSISYLGGNTQARRRSEFAVDHVFSSSQRASQVKNRIAVVVT
DGKSQDDVVDASMEARTQGVTVFAVGVGSEITTSELIAIANKPSSTYVLYAEDYTTIHHI
RDAMEQKLCEESVCPTRIPVSSRDEKGFELIIGMKLPSKARKIPGSLISETAYPQTIKSC
LFNMFTREIFPEGLPPSYVFVATVRIKASSSKLTFDLWRVLSKDKKIQAAVTLNGKDRSV
IFVTTRTTDKQQRVVF
Download sequence
Identical sequences H3CBH1
ENSTNIP00000005593 ENSTNIP00000005593 99883.ENSTNIP00000005593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]