SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005601 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005601
Domain Number 1 Region: 127-256
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.00081
Further Details:      
 
Domain Number 2 Region: 43-139
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000857
Family Cadherin 0.0029
Further Details:      
 
Domain Number 3 Region: 393-441
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000585
Family Cadherin 0.0034
Further Details:      
 
Domain Number 4 Region: 253-313
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000957
Family Cadherin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005601   Gene: ENSTNIG00000003031   Transcript: ENSTNIT00000005749
Sequence length 445
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56210705:56214950:-1 gene:ENSTNIG00000003031 transcript:ENSTNIT00000005749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEQSPQALLFLLLIHATLDQGQSDYAPYFYDNGASSKNGNMALFSISEDTAVGTQVYV
LNGTDPEGDPVRYGLTFEKGSKEYFRVDSKSGNVSLIQELDREKQDEISVLVSITDGRNK
VVETVRVFVTDANDEAPEFQNPPFIVAVSEDTAAGSSIYRVQAVDRDMGSGGSVSYFLQV
VVIRCQTSPFSKFTIDGHSGILRIKPGETLDYETTPTHFVTVVAKDGGGKYKGRNQVLSS
TATITVNVIDAQDMPPSFIGTPYFGYIYEVSVPGSEIITVSARDGDQGNPNPIFYSILNG
KGSGTMSVVHPFDVLMVFHLPGSDGVFEYVHSCFTRTCQITKLHKFLFSICYGVPVIKLH
CSFLSSQLLAVEIDTPERFSATADIVINLLDTNDNVPKFTSEYYIARIPENSAGGSSVAT
VTANDPDSGPWGEVKYTIYGSGSDL
Download sequence
Identical sequences H3CBH9
ENSTNIP00000005601 99883.ENSTNIP00000005601 ENSTNIP00000005601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]