SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005679 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005679
Domain Number 1 Region: 405-647
Classification Level Classification E-value
Superfamily NHL repeat 6.93e-42
Family NHL repeat 0.0000221
Further Details:      
 
Domain Number 2 Region: 235-330
Classification Level Classification E-value
Superfamily E set domains 1.6e-19
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 20-81
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000717
Family B-box zinc-binding domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005679
Domain Number - Region: 92-159
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0196
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005679   Gene: ENSTNIG00000003107   Transcript: ENSTNIT00000005827
Sequence length 649
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56693052:56695918:-1 gene:ENSTNIG00000003107 transcript:ENSTNIT00000005827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMEAGQRSPDSSSEECTVLEAPPPRNTCLRHAAKVAHLYCAACARALCEDCAAEHQDHPT
LPLDQGLQQQRRRLQGALSSVQSRLPQVSEALSLVRELLQQLSAQRASMEEDIQSHFQDL
HKQLDVRRSVLLMELEVTYGLKQKVLQAQVEHLVQAEQDMVSSCSRCQEVLEGEACVAGL
QAEREVEEQLLQAAQRPASCQPEENHQLDLLMDTDALRKSVHNLGPSSPPVSAVASQSEA
MGVGLEECLVGHPASVTVVTRDKSGGACKSGNAVLSAEVFTPDGSIVDGELVDHNNGTYE
FVYVIPREGDFLGVRLYDQHIKGSPFRLKAAYATPSTGSSDGAKRRGKSPAQKKKASKRA
SSALGTPRRRTQNPIEDDLIFKIGSKGRNKGEFTNLQGVATATCSILIADSNNQCVQIFS
NHGEFRNRFGVRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSCDGKFKAKLGSGR
LLGPKGVSVDQNGHVIVVDNKACSVFVFQLSGKLVAKFGSRGNGIHAAGPHFAAVNKNNE
IIVTDFHNHSVKVFSPDGELLLKFGSNGEGNGQFNAPTGVAVDDNGNIVVADWGNSRIQV
FDGSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences H3CBQ7
99883.ENSTNIP00000005679 ENSTNIP00000005679 ENSTNIP00000005679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]