SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005680 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005680
Domain Number 1 Region: 404-646
Classification Level Classification E-value
Superfamily NHL repeat 7.19e-42
Family NHL repeat 0.0000206
Further Details:      
 
Domain Number 2 Region: 233-329
Classification Level Classification E-value
Superfamily E set domains 3.87e-22
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 20-81
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000717
Family B-box zinc-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005680   Gene: ENSTNIG00000003108   Transcript: ENSTNIT00000005828
Sequence length 648
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56706850:56709710:-1 gene:ENSTNIG00000003108 transcript:ENSTNIT00000005828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMEAGQRSPDSSSEECTVLEAPPPRNTCLRHAAKVAHLYCAACARALCEDCAAEHQDHPT
LPLDQGLQQQRRRLQGALSSVQSRLPQVSEALSLVRELLQQLSAQRASMEEDIQSHFQDL
HKQLDVRRSVLLMELEVTYGLKQKVRPRSARVRRCGEDMVSSCSRCQEVLEGEACVAGLQ
AEREVEEQLLQAAHVSASCQPEENHQLDLLMDTDALRKSVHNLGTIVTTSAVASQSEAMG
AGLEECLVGHPASVTVVTRDKSGGACKSGNAVLSAEVFTPDGSIVDGELVDHNNGTYEFV
YVIPREGDFSLALRLYDQHIKGSPFRLKVRSQVEVRVRADGAKRRGKSPAQKKKASKRAS
SALGTPRRRTQNPIEDDLIFKIGSKGRNKGEFTNLQGVATATCSILIADSNNQCVQIFSN
HGEFRNRFGVRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSCDGKFKAKLGSGRL
LGPKGVSVDQNGHVIVVDNKACSVFVFQLSGKLVAKFGSRGNGDTQLAGPHFAAVNKNNE
IIVTDFHNHSVKVFSPDGELLLKFGSNGEGNGQFNAPTGVALDDNGNIVVADWGNSRIQV
FDGSGSFLSYINTSADLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences H3CBQ8
99883.ENSTNIP00000005680 ENSTNIP00000005680 ENSTNIP00000005680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]