SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005682 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005682
Domain Number 1 Region: 232-490
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.19e-94
Family Fibrinogen C-terminal domain-like 0.00000000278
Further Details:      
 
Domain Number 2 Region: 92-228
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 3.68e-52
Family Fibrinogen coiled-coil and central regions 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005682   Gene: ENSTNIG00000003110   Transcript: ENSTNIT00000005830
Sequence length 493
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56720508:56722978:1 gene:ENSTNIG00000003110 transcript:ENSTNIT00000005830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLLLVYLCTYAVWGRSLDYDDDDDDGDGKASVAANATAAVDARGHRPLQRGREAYSPV
RNAPPPISSGSRYRGRPSAPQVSPGRVQEKEEQPDRGGCSHASQELGVLCPNGCELKTAL
LKQERDVRTSISELQPQVEQLTRSSNDVHNYVSRVSASLRERQRVIGDNSATVSRYTDSV
EEQHAYIKETVDTVFPSSIRILQGVLDQVRQKIQKLEKAIQAQQEDCKEPCRTRCPIPVV
SGKECEDIFRRGGTESQMYLVQPDTAAPPYRVFCDQITHNGGWLLIQSRLDGSVDFGRRW
DDYRRGFGNVALDAGKGRCDTPGEYWLGNDRISQLTNAGPTELLIEMQDWTGAKVFARYQ
KFTVQSAASNYVLAVDGYSGNAGNSFMEGSLELFGVNRTMTIHNGMMFSTYDRDNDNWTP
GDPAKQCSREDGGGWWYNRCHSSNPNGRYYMGGAYTRHMAKHGTDDGVVWMNWKGSWYSQ
KAISMKVRPFFKS
Download sequence
Identical sequences H3CBR0
99883.ENSTNIP00000005682 ENSTNIP00000005682 ENSTNIP00000005682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]