SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005685 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005685
Domain Number 1 Region: 674-915
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-77
Family Eukaryotic proteases 0.0000436
Further Details:      
 
Domain Number 2 Region: 333-452
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-33
Family Frizzled cysteine-rich domain 0.00025
Further Details:      
 
Domain Number 3 Region: 2-115
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.8e-30
Family Frizzled cysteine-rich domain 0.00043
Further Details:      
 
Domain Number 4 Region: 147-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 459-497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 533-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 7 Region: 258-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 220-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 184-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 501-531
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000524
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 11 Region: 591-665
Classification Level Classification E-value
Superfamily SRCR-like 0.000034
Family Hepsin, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005685   Gene: ENSTNIG00000003113   Transcript: ENSTNIT00000005833
Sequence length 923
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56765035:56770148:1 gene:ENSTNIG00000003113 transcript:ENSTNIT00000005833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCQPITEPQCHMLPYNQTWLSASVSVVKSSEVDMLLRFFSYLSRLSCYRHIMLFGCSLAL
PECVAAGHAHNRTVVLPCASFCEAAREGCEPVLQMFNATWPDFLRCSQFNDSAPPSAPPS
SPPAAAGPAHSTCYTPRQMKGKASVCRGRDHFQCATGICIPQKLVCNGYNDCDDWSDETH
CGHACPTGSFRCNTGRCLSRLRCDGYDDCGDLSDELNCVCDPVREHRCSDGRCVSTDWLC
DGDHDCVDKSDELNCSCKSQGLLECRNGQCIPSAFRCDGEDDCKDGSDEEHCSREQTPSA
CLPGQPSCISTSCPGACGASSGACDPGSGSSCARCEPIGLELCRNLPYNSTSSPNFLGHQ
SQRESSVSWEASLFPALVQTGCYQYLMFYACTLLVPKCDPVTALRVPPCRSLCRTSRSRC
ESVLSVVGLQWPEDSDCSQFPEDGGPLPCLLPEAGVDECSPSHFKCGSGRCVLAGKRCDG
HLDCDDHSDEDNCGCAERALWECPGSKTCITASMICDGFPDCPLLADEHNCSTCSDNQLA
CSNHQCVHRSLWCDGKTHCSDASDEWDCGNALVVSAHTGWVLTVLRSAAEYQVCADEWTA
ALSALTCAQLGRGKGSRKGGGTRAERWIKVKTEWRRRNGTALQARLEKRSHACHSGRRVS
LRCSRPDCGERPALRGHRHRKRRILGGRVSRQGAWPWQCSLQTGSSGHVCGCVLIGRRWA
LTVAHCFEGRESADLWKVVFGLTNLDHPGPHSQTLGVRSIIVHPRYNRAVVDYDISVLQL
DAEVDVTDFVRPVCLPEPGQVPTPDSYCYISGWGHMGNRMPFKLQEGPVRLMSMSQCQSY
FDMKTITSRMLCAGYDAGTVDSCMGDSGGPLVCEDEGRWTLLGLTSWGSVCFSKVLGPGV
YSNVTHFSPWIQQQIYTHTYLSD
Download sequence
Identical sequences H3CBR3
ENSTNIP00000005685 ENSTNIP00000005685 99883.ENSTNIP00000005685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]