SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005687 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000005687
Domain Number - Region: 22-87
Classification Level Classification E-value
Superfamily Cadherin-like 0.0141
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005687   Gene: ENSTNIG00000003115   Transcript: ENSTNIT00000005835
Sequence length 128
Comment pep:novel chromosome:TETRAODON8:Un_random:56786234:56787521:-1 gene:ENSTNIG00000003115 transcript:ENSTNIT00000005835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVSENRCVCPVNKPACRDLPFSIVNRYMSITSERSVPSDIFQIQATSVSPGAYNTFRIR
SGDENGDFYIRQINNISAMLVLARAVSGPREYTLDLEMVTVNPLFSYQGAYQSSSALRLS
IYVGPYTF
Download sequence
Identical sequences H3CBR5
ENSTNIP00000005687 99883.ENSTNIP00000005687 ENSTNIP00000005687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]