SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005698 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000005698
Domain Number - Region: 675-706
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000134
Family MYND zinc finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005698   Gene: ENSTNIG00000003126   Transcript: ENSTNIT00000005846
Sequence length 961
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:33196057:33199311:1 gene:ENSTNIG00000003126 transcript:ENSTNIT00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTDLADKLLSTVHQNIKVIPIFPRYKQSEKCNSGHYCTLEISNIKARKRNCHTFGSKY
RFSAPDIFSSKLTPQPTSADMAGEVPVSDQKRRTRSKSAPRVPTRVTAMPCEETSSSGRK
GRGSQRASRESSWRPEMSPRRESSYASTRSHVHEVHPIKLQPQRSNIGKHSSHYVADNPD
DGGPDKPATSPHVRCRMDIKPDESLLHYSRLSRTPTPTDSLGAENRMPSSSDYYGRERRA
HSIPNVPTKFFYADDSSLLSGSTPHPQYKSYYPDERTPYTPKPGYPKAYSAHEPGQYIVQ
TPPSRIFYGDDPKSHQIQTAPPRFYFSRDMYPMPPAHHIPARAYYTEGRRHARVVQPQAD
DWYGSDVSCYSTNPASYVSQVTPTRVQQEPVLASWYANPCVEPQRMGTDSKSYSRSWDNI
LNSRVEREQPYSVQRGQSFDDLHEPRKPEAAVGDKPQPVVVNLSSSPRRYAALSMSDNSL
IDKSPTETSKSAPGKHWFVTPEITITDNDIQPGKFNKIEGRSASWDVFDSRSADVPEQPD
FETSTKETTHDNASLQQSLEQLDELLADLVTDYKPPSRRASEDILDQLKKLIDEEEAVSL
SRKSSKVAAEEPAPLDRQPTSIRMNPDAFRDIDGASDAMKSVDECSPDQSPDEDDTMMCS
NNKCRRTETLFNACLYFKSCHSCYTYYCSRNCRREDWDVHKESCLYGRIGSTCRHIIKHC
RETVDVHKFFSRIAKVGYLSRGRGVLFLGFPNPASSSNFLQYGLDSLPMSPTYLSLRELE
SFKDNLGEYFKELREAGKEYDPNECFILNVSIAVGEQLPEGPSPRHQAPTVRKYAKVALA
SFSPERNVHKKESDMETLILTPPPGTADMDKEGEVGRKAREVCFINIQRELRIRGVFLRH
EFPQVYQQLCEFVEDNRRFTPTTIYPIDKRTGKQFMCMIMAASEPRTLDWVGTPHLLDDI
M
Download sequence
Identical sequences H3CBS6
ENSTNIP00000005698 ENSTNIP00000005698 99883.ENSTNIP00000005698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]