SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005705 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005705
Domain Number 1 Region: 282-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000171
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005705   Gene: ENSTNIG00000003133   Transcript: ENSTNIT00000005853
Sequence length 371
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:33280731:33283545:1 gene:ENSTNIG00000003133 transcript:ENSTNIT00000005853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAGMAAGLSRDAVLLYLQSRGGSVRNAELLQRFRGYIREDPDRDRNRELFKRFVNSLAT
VQQVDGVSYVVLRKKFRGGPGPPAGPGQPPSRDPRGPGPPAGPGQPPSRDPRGPGPPAGP
GQPPSRDPRGPGPPAGPAGGQPFGGVGKAPPPPSTASPAPSSPSSSSSESLCFQPPPSGI
PESRSSSRGASCARRAAPPTISTWTRSPPCGPGAPPQKTAGGARGEGAGRSRSPAAGAKA
HDEDHARQSLVPLEAREHAWLVKGAAGAWPDIYSLFREDSSLLNRKDFISGFTVLHWIAK
HGDHRVLNTLWYGVEKAGLTFDVNARSTSGHTPLHIAAIHGHKNIIRLLVRKFNADVRLR
DTAGKKAWHYL
Download sequence
Identical sequences H3CBT3
ENSTNIP00000005705 ENSTNIP00000004058 99883.ENSTNIP00000005705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]