SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005719 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005719
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily UBA-like 1.3e-27
Family UBA domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005719   Gene: ENSTNIG00000003146   Transcript: ENSTNIT00000005867
Sequence length 159
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:56981243:56986871:1 gene:ENSTNIG00000003146 transcript:ENSTNIT00000005867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEQNVLQQHSQKHQQTLLNQLKEITGTTDVQLLQQALQASDGDMTEAVAFLTEKNVQA
SPQDESSYDQTSQLTSDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESSRAFRETG
ITDEEQAISSVLMPASAENKATLKRSHLEAWSDSPNPHE
Download sequence
Identical sequences H3CBU7
ENSTNIP00000005719 99883.ENSTNIP00000005719 ENSTNIP00000005719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]