SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005725 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005725
Domain Number 1 Region: 142-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-24
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 2 Region: 7-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-23
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 3 Region: 297-479
Classification Level Classification E-value
Superfamily vWA-like 1.18e-16
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005725   Gene: ENSTNIG00000003152   Transcript: ENSTNIT00000005873
Sequence length 542
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:13310741:13346226:-1 gene:ENSTNIG00000003152 transcript:ENSTNIT00000005873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLNSSVPATKIEVTVSCRNLLDMDTFSKSDPVVVLYMQGLGTKEWREFGRTEVIDNTLNP
DFVRKFVMDFFFEEKQNLRFDVYNVDTRSSNFSKHDFLGQTFCTLGEIIGSVGGRLERTL
SLLNGIPGKKCGTIIFAAEELSNCRDIATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGT
FTICHKTEVIKNNLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWDRDGSHDFIGEFTTSY
RELSRGQNQFNVYEVDVLNPKKKGRKKKYVNSGTVTLLSFKVESEYTFVDFIRGGTQLNF
TVAIDFTASNGNPSQPTSLHYMNPYQLNMYAMALKAVGDIIQDYDSDKLFPAYGFGAKLP
PDGKISHAFPLNSQADNPNCVGIDGVLEAYFQSLRTVQLYGPTNFAPVISQVARCAAEVT
DGSQYFVLLMITDGVISDMAQTKESVVNASSLPMSIIIVGVGPAEFDAMEELDGDDVRVS
SRGRFAERDIVQFVPFRDYIDRSGNQVLSMARLAKDVLAEIPEQVLSFMKSRGIGPRPLV
PI
Download sequence
Identical sequences H3CBV3
ENSTNIP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]